Castor canadensis (American beaver): 109684092 Help Entry 109684092         CDS       T04791                                  Symbol Pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism ccan  Castor canadensis (American beaver) Pathway ccan03030   DNA replication ccan03082   ATP-dependent chromatin remodeling ccan03410   Base excision repair ccan03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     109684092 (Pole3)    03410 Base excision repair     109684092 (Pole3)    03420 Nucleotide excision repair     109684092 (Pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     109684092 (Pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccan03032]     109684092 (Pole3)    03036 Chromosome and associated proteins [BR:ccan03036]     109684092 (Pole3)    03400 DNA repair and recombination proteins [BR:ccan03400]     109684092 (Pole3) Enzymes [BR:ccan01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      109684092 (Pole3) DNA replication proteins [BR:ccan03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     109684092 (Pole3) Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     109684092 (Pole3) DNA repair and recombination proteins [BR:ccan03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       109684092 (Pole3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C BUD22 CIS_TMP DUF4746 Myc_N TiaS_TCKD SpoU_methylase TAF RNA_pol_3_Rpc31 Pox_Ag35 CDC45 NOA36 DDHD CLN3 V_ATPase_I Motif Other DBs NCBI-GeneID:  109684092 NCBI-ProteinID:  XP_020015903 UniProt:  A0A250YA40 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLNASDVLSAMEEMEFQRFIVPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQD KNRDEDNDEDEERLEEEEQNEEEEVDN NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcggagagacccgaggacctaaatctgcccaacgccgtcatcaccaggatcatcaag gaggcgctcccggacggtgtcaacatctctaaggaggcccggagcgccatctctcgcgcc gccagcgtcttcgtgctgtacgccacgtcctgtgccaacaacttcgctatgaaggggaag cgcaagacactcaatgccagtgatgtgctctcagccatggaagagatggagttccagagg ttcattgtcccgctcaaagaagctctagaagcatataggcgggagcagaaaggcaagaag gaagcttcggagcaaaagaagaaggacaaagacaaaaaaacagattcagaagagcaagac aagaacagggacgaggacaatgatgaagatgaggaaaggctggaagaagaagaacagaat gaagaagaggaagtagacaactga

DBGET integrated database retrieval system