Castor canadensis (American beaver): 109684671 Help Entry 109684671         CDS       T04791                                  Name (RefSeq) cyclin-dependent kinase 6-like   KO K02091   cyclin-dependent kinase 6 [EC:2.7.11.22] Organism ccan  Castor canadensis (American beaver) Pathway ccan04110   Cell cycle ccan04115   p53 signaling pathway ccan04151   PI3K-Akt signaling pathway ccan04218   Cellular senescence ccan04934   Cushing syndrome ccan05160   Hepatitis C ccan05162   Measles ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05165   Human papillomavirus infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05169   Epstein-Barr virus infection ccan05200   Pathways in cancer ccan05203   Viral carcinogenesis ccan05206   MicroRNAs in cancer ccan05212   Pancreatic cancer ccan05214   Glioma ccan05218   Melanoma ccan05220   Chronic myeloid leukemia ccan05222   Small cell lung cancer ccan05223   Non-small cell lung cancer ccan05224   Breast cancer ccan05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     109684671  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     109684671    04115 p53 signaling pathway     109684671    04218 Cellular senescence     109684671  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109684671    05206 MicroRNAs in cancer     109684671    05203 Viral carcinogenesis     109684671   09162 Cancer: specific types    05212 Pancreatic cancer     109684671    05225 Hepatocellular carcinoma     109684671    05214 Glioma     109684671    05220 Chronic myeloid leukemia     109684671    05218 Melanoma     109684671    05224 Breast cancer     109684671    05222 Small cell lung cancer     109684671    05223 Non-small cell lung cancer     109684671   09172 Infectious disease: viral    05160 Hepatitis C     109684671    05164 Influenza A     109684671    05162 Measles     109684671    05163 Human cytomegalovirus infection     109684671    05167 Kaposi sarcoma-associated herpesvirus infection     109684671    05169 Epstein-Barr virus infection     109684671    05165 Human papillomavirus infection     109684671   09167 Endocrine and metabolic disease    04934 Cushing syndrome     109684671  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ccan01001]     109684671 Enzymes [BR:ccan01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      109684671 Protein kinases [BR:ccan01001]  Serine/threonine kinases: CMGC group   CDK family    109684671 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Motif Other DBs NCBI-GeneID:  109684671 NCBI-ProteinID:  XP_020016737 UniProt:  A0A8B7UBU5 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MVLRTDRPDEACSSELHRLQGGLQLVLLCHPTKKEFEVVTLWYRAPEVLLQSSYATPVDL WSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPI EKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSE LNTA NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atggtgctgcgcacagaccgtccagatgaagcatgctcgtctgaattacaccggctacag ggtggcctacagcttgtgttactttgccatcctactaagaaagagtttgaggtcgtcaca ctgtggtaccgggctccagaagtcttgctccagtccagctatgctacccccgtggacctc tggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgtggaagt tcagatgtggatcagctaggaaaaatcttggatgtaattggactcccaggagaagaggac tggcctagagatgttgcccttcccaggcaggcatttcattccaaatctgcccaacccatt gagaagtttgtaacagatattgatgaactaggcaaagacctacttctgaagtgcttgaca tttaatccagccaaaagaatatctgcctacagtgccctgtctcacccatacttccaagac ctggagaggtgcaaggaaaacctggattcccacctgccacccagccagaatacctcagag ctgaacacagcctga

DBGET integrated database retrieval system