Castor canadensis (American beaver): 109684969 Help Entry 109684969         CDS       T04791                                  Name (RefSeq) fibroblast growth factor 1-like   KO K18496   fibroblast growth factor 1 Organism ccan  Castor canadensis (American beaver) Pathway ccan04010   MAPK signaling pathway ccan04014   Ras signaling pathway ccan04015   Rap1 signaling pathway ccan04020   Calcium signaling pathway ccan04151   PI3K-Akt signaling pathway ccan04390   Hippo signaling pathway ccan04810   Regulation of actin cytoskeleton ccan05200   Pathways in cancer ccan05218   Melanoma ccan05224   Breast cancer ccan05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109684969    04014 Ras signaling pathway     109684969    04015 Rap1 signaling pathway     109684969    04390 Hippo signaling pathway     109684969    04020 Calcium signaling pathway     109684969    04151 PI3K-Akt signaling pathway     109684969  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109684969  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109684969   09162 Cancer: specific types    05226 Gastric cancer     109684969    05218 Melanoma     109684969    05224 Breast cancer     109684969  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109684969    00536 Glycosaminoglycan binding proteins [BR:ccan00536]     109684969 Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Growth factors (RTK binding)    109684969 Glycosaminoglycan binding proteins [BR:ccan00536]  Heparan sulfate / Heparin   Growth factors/receptors    109684969 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  109684969 NCBI-ProteinID:  XP_020017191 UniProt:  A0A8B7UCD0 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search QLQLSAESVGEVYIKSTETGQYLAMDPEGLLYGSQTPDEECLFLERLEENHYNTYISKKH AEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPCQSPLIREICSGC NT seq 320 nt NT seq  +upstreamnt  +downstreamnt ttcagctgcagctgagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactg gccagtacttggccatggaccctgaggggcttttatacggctcacagacaccagatgaag aatgcttgttcctggagaggctggaggaaaaccattacaacacctacatatccaagaaac atgcagagaagaattggtttgttggtctcaagaagaacggaagctgcaaacgtgggcctc ggactcactacggccagaaagcaatcctgtttctcccctgccagtctcctctgattagag aaatctgttctgggtgctaa

DBGET integrated database retrieval system