Castor canadensis (American beaver): 109685266 Help Entry 109685266         CDS       T04791                                  Symbol Rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism ccan  Castor canadensis (American beaver) Pathway ccan04072   Phospholipase D signaling pathway ccan04140   Autophagy - animal ccan04150   mTOR signaling pathway ccan04151   PI3K-Akt signaling pathway ccan04152   AMPK signaling pathway ccan04211   Longevity regulating pathway ccan04218   Cellular senescence ccan04714   Thermogenesis ccan04910   Insulin signaling pathway ccan04919   Thyroid hormone signaling pathway ccan05163   Human cytomegalovirus infection ccan05165   Human papillomavirus infection ccan05168   Herpes simplex virus 1 infection ccan05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     109685266 (Rheb)    04151 PI3K-Akt signaling pathway     109685266 (Rheb)    04152 AMPK signaling pathway     109685266 (Rheb)    04150 mTOR signaling pathway     109685266 (Rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109685266 (Rheb)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     109685266 (Rheb)   09149 Aging    04211 Longevity regulating pathway     109685266 (Rheb)   09159 Environmental adaptation    04714 Thermogenesis     109685266 (Rheb)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     109685266 (Rheb)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     109685266 (Rheb)    05165 Human papillomavirus infection     109685266 (Rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ccan04031]     109685266 (Rheb) GTP-binding proteins [BR:ccan04031]  Small (monomeric) G-proteins   Ras Family    Rheb     109685266 (Rheb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  109685266 NCBI-ProteinID:  XP_020017606 UniProt:  A0A250XVS1 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFKRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtctcggaagatcgcgatactgggctaccggtctgtggggaagtcc tcattgacgattcagtttgttgaaggccaatttgttgactcctacgatccaaccatagaa aacactttcacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac acagctgggcaagatgaatattctatttttcctcagacatactccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat ggcaaattgttggatatggtggggaaagtacaaatacctattatgttggttgggaataag aaagacctgcatatggaaagggtgatcagctatgaagaagggaaagctttggcagagtct tggaacgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt aaaaggataattttggaggcagaaaaaatagatggggcagcatcacaaggaaagtcttca tgctcagtgatgtga

DBGET integrated database retrieval system