Castor canadensis (American beaver): 109685333 Help Entry 109685333         CDS       T04791                                  Symbol Gsk3b Name (RefSeq) glycogen synthase kinase-3 beta   KO K03083   glycogen synthase kinase 3 beta [EC:2.7.11.26] Organism ccan  Castor canadensis (American beaver) Pathway ccan01521   EGFR tyrosine kinase inhibitor resistance ccan04012   ErbB signaling pathway ccan04062   Chemokine signaling pathway ccan04110   Cell cycle ccan04150   mTOR signaling pathway ccan04151   PI3K-Akt signaling pathway ccan04310   Wnt signaling pathway ccan04340   Hedgehog signaling pathway ccan04360   Axon guidance ccan04390   Hippo signaling pathway ccan04510   Focal adhesion ccan04550   Signaling pathways regulating pluripotency of stem cells ccan04657   IL-17 signaling pathway ccan04660   T cell receptor signaling pathway ccan04662   B cell receptor signaling pathway ccan04722   Neurotrophin signaling pathway ccan04728   Dopaminergic synapse ccan04910   Insulin signaling pathway ccan04916   Melanogenesis ccan04917   Prolactin signaling pathway ccan04919   Thyroid hormone signaling pathway ccan04931   Insulin resistance ccan04932   Non-alcoholic fatty liver disease ccan04934   Cushing syndrome ccan04935   Growth hormone synthesis, secretion and action ccan04936   Alcoholic liver disease ccan05010   Alzheimer disease ccan05020   Prion disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05135   Yersinia infection ccan05160   Hepatitis C ccan05162   Measles ccan05163   Human cytomegalovirus infection ccan05165   Human papillomavirus infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05200   Pathways in cancer ccan05210   Colorectal cancer ccan05213   Endometrial cancer ccan05215   Prostate cancer ccan05217   Basal cell carcinoma ccan05224   Breast cancer ccan05225   Hepatocellular carcinoma ccan05226   Gastric cancer ccan05415   Diabetic cardiomyopathy ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04012 ErbB signaling pathway     109685333 (Gsk3b)    04310 Wnt signaling pathway     109685333 (Gsk3b)    04340 Hedgehog signaling pathway     109685333 (Gsk3b)    04390 Hippo signaling pathway     109685333 (Gsk3b)    04151 PI3K-Akt signaling pathway     109685333 (Gsk3b)    04150 mTOR signaling pathway     109685333 (Gsk3b)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     109685333 (Gsk3b)   09144 Cellular community - eukaryotes    04510 Focal adhesion     109685333 (Gsk3b)    04550 Signaling pathways regulating pluripotency of stem cells     109685333 (Gsk3b)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     109685333 (Gsk3b)    04657 IL-17 signaling pathway     109685333 (Gsk3b)    04662 B cell receptor signaling pathway     109685333 (Gsk3b)    04062 Chemokine signaling pathway     109685333 (Gsk3b)   09152 Endocrine system    04910 Insulin signaling pathway     109685333 (Gsk3b)    04917 Prolactin signaling pathway     109685333 (Gsk3b)    04935 Growth hormone synthesis, secretion and action     109685333 (Gsk3b)    04919 Thyroid hormone signaling pathway     109685333 (Gsk3b)    04916 Melanogenesis     109685333 (Gsk3b)   09156 Nervous system    04728 Dopaminergic synapse     109685333 (Gsk3b)    04722 Neurotrophin signaling pathway     109685333 (Gsk3b)   09158 Development and regeneration    04360 Axon guidance     109685333 (Gsk3b)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109685333 (Gsk3b)   09162 Cancer: specific types    05210 Colorectal cancer     109685333 (Gsk3b)    05225 Hepatocellular carcinoma     109685333 (Gsk3b)    05226 Gastric cancer     109685333 (Gsk3b)    05217 Basal cell carcinoma     109685333 (Gsk3b)    05215 Prostate cancer     109685333 (Gsk3b)    05213 Endometrial cancer     109685333 (Gsk3b)    05224 Breast cancer     109685333 (Gsk3b)   09172 Infectious disease: viral    05160 Hepatitis C     109685333 (Gsk3b)    05162 Measles     109685333 (Gsk3b)    05163 Human cytomegalovirus infection     109685333 (Gsk3b)    05167 Kaposi sarcoma-associated herpesvirus infection     109685333 (Gsk3b)    05165 Human papillomavirus infection     109685333 (Gsk3b)   09171 Infectious disease: bacterial    05135 Yersinia infection     109685333 (Gsk3b)   09164 Neurodegenerative disease    05010 Alzheimer disease     109685333 (Gsk3b)    05020 Prion disease     109685333 (Gsk3b)    05022 Pathways of neurodegeneration - multiple diseases     109685333 (Gsk3b)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109685333 (Gsk3b)    05415 Diabetic cardiomyopathy     109685333 (Gsk3b)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     109685333 (Gsk3b)    04932 Non-alcoholic fatty liver disease     109685333 (Gsk3b)    04931 Insulin resistance     109685333 (Gsk3b)    04934 Cushing syndrome     109685333 (Gsk3b)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109685333 (Gsk3b)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ccan01001]     109685333 (Gsk3b)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccan03036]     109685333 (Gsk3b) Enzymes [BR:ccan01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.26  tau-protein kinase      109685333 (Gsk3b) Protein kinases [BR:ccan01001]  Serine/threonine kinases: CMGC group   GSK family [OT]    109685333 (Gsk3b) Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Centrosome formation proteins    Kinases and associated factors     109685333 (Gsk3b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like Kdo APH Motif Other DBs NCBI-GeneID:  109685333 NCBI-ProteinID:  XP_020017718 UniProt:  A0A8B7UDL0 LinkDB All DBs Position Unknown AA seq 442 aa AA seqDB search MTTVLLTGIELRALQGYVTHVPCCFSLLFKQGLVLLPVMASDSDLSTSTSKRDKDGSKVT TVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNREL QIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYV KLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYIC SRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTR EQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHS FFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAAS DANAGDRGQTNNAASASASNST NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt atgaccacagtactccttacagggattgaactcagggccttgcaaggctacgtgacccat gtcccctgttgttttagtttgcttttcaaacaaggcctcgtacttttgcctgtgatggct tcagacagtgatctttctacctcaacctccaaaagagataaggatggcagcaaggtgacc acagtggtggcaactcctgggcagggtccagataggccacaagaagtcagctatacagat actaaagtgattggaaatggatcatttggtgtggtgtatcaagccaaactttgtgattca ggagaattggttgccatcaagaaagtattacaggacaagagatttaagaaccgagagctc cagatcatgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactca agcggtgagaagaaagatgaggtctaccttaatctggtgctggactatgttccggaaaca gtgtacagagttgccagacactatagtcgagccaaacaaacactccctgtgatctatgtc aagttgtatatgtatcagctgttcagaagtttagcctatatccattcctttggaatttgc catcgggatattaaaccacaaaacctcctgctggatcctgacacggctgtcttaaaactc tgtgattttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgt tctcggtactatagggcaccagagttgatctttggagccactgattatacctctagtata gatgtatggtctgcgggctgtgtgttagctgagctgttgctaggacaaccaatatttcca ggggacagtggtgtggatcaattggtggaaataatcaaggtcctgggaacaccaacaagg gagcaaattagagaaatgaacccaaattatacagaattcaaattccctcaaattaaggca catccttggacaaaggtcttccgaccccgaactccaccagaagcaattgcactgtgtagc cgtctactggagtatacaccaactgcccgattgacaccactagaggcttgtgcacattca ttttttgatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgca ctcttcaacttcactactcaagaactttcaagtaatccacctctggctaccatccttatt cctcctcatgctcggattcaagcagctgcttcaactcctacaaatgccacagcagcctca gatgctaatgctggagaccgtgggcagaccaataacgccgcttctgcatcagcttccaac tccacctga

DBGET integrated database retrieval system