KEGG   Castor canadensis (American beaver): 109686235
Entry
109686235         CDS       T04791                                 
Symbol
Akt3
Name
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01521  EGFR tyrosine kinase inhibitor resistance
ccan01522  Endocrine resistance
ccan01524  Platinum drug resistance
ccan04010  MAPK signaling pathway
ccan04012  ErbB signaling pathway
ccan04014  Ras signaling pathway
ccan04015  Rap1 signaling pathway
ccan04022  cGMP-PKG signaling pathway
ccan04024  cAMP signaling pathway
ccan04062  Chemokine signaling pathway
ccan04066  HIF-1 signaling pathway
ccan04068  FoxO signaling pathway
ccan04071  Sphingolipid signaling pathway
ccan04072  Phospholipase D signaling pathway
ccan04140  Autophagy - animal
ccan04150  mTOR signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04152  AMPK signaling pathway
ccan04210  Apoptosis
ccan04211  Longevity regulating pathway
ccan04213  Longevity regulating pathway - multiple species
ccan04218  Cellular senescence
ccan04261  Adrenergic signaling in cardiomyocytes
ccan04370  VEGF signaling pathway
ccan04371  Apelin signaling pathway
ccan04380  Osteoclast differentiation
ccan04510  Focal adhesion
ccan04517  IgSF CAM signaling
ccan04518  Integrin signaling
ccan04550  Signaling pathways regulating pluripotency of stem cells
ccan04611  Platelet activation
ccan04613  Neutrophil extracellular trap formation
ccan04620  Toll-like receptor signaling pathway
ccan04625  C-type lectin receptor signaling pathway
ccan04630  JAK-STAT signaling pathway
ccan04660  T cell receptor signaling pathway
ccan04662  B cell receptor signaling pathway
ccan04664  Fc epsilon RI signaling pathway
ccan04666  Fc gamma R-mediated phagocytosis
ccan04668  TNF signaling pathway
ccan04722  Neurotrophin signaling pathway
ccan04725  Cholinergic synapse
ccan04728  Dopaminergic synapse
ccan04810  Regulation of actin cytoskeleton
ccan04910  Insulin signaling pathway
ccan04914  Progesterone-mediated oocyte maturation
ccan04915  Estrogen signaling pathway
ccan04917  Prolactin signaling pathway
ccan04919  Thyroid hormone signaling pathway
ccan04920  Adipocytokine signaling pathway
ccan04922  Glucagon signaling pathway
ccan04923  Regulation of lipolysis in adipocytes
ccan04926  Relaxin signaling pathway
ccan04929  GnRH secretion
ccan04931  Insulin resistance
ccan04932  Non-alcoholic fatty liver disease
ccan04933  AGE-RAGE signaling pathway in diabetic complications
ccan04935  Growth hormone synthesis, secretion and action
ccan04936  Alcoholic liver disease
ccan04973  Carbohydrate digestion and absorption
ccan05010  Alzheimer disease
ccan05017  Spinocerebellar ataxia
ccan05132  Salmonella infection
ccan05135  Yersinia infection
ccan05142  Chagas disease
ccan05145  Toxoplasmosis
ccan05152  Tuberculosis
ccan05160  Hepatitis C
ccan05161  Hepatitis B
ccan05162  Measles
ccan05163  Human cytomegalovirus infection
ccan05164  Influenza A
ccan05165  Human papillomavirus infection
ccan05166  Human T-cell leukemia virus 1 infection
ccan05167  Kaposi sarcoma-associated herpesvirus infection
ccan05168  Herpes simplex virus 1 infection
ccan05169  Epstein-Barr virus infection
ccan05170  Human immunodeficiency virus 1 infection
ccan05200  Pathways in cancer
ccan05205  Proteoglycans in cancer
ccan05207  Chemical carcinogenesis - receptor activation
ccan05208  Chemical carcinogenesis - reactive oxygen species
ccan05210  Colorectal cancer
ccan05211  Renal cell carcinoma
ccan05212  Pancreatic cancer
ccan05213  Endometrial cancer
ccan05214  Glioma
ccan05215  Prostate cancer
ccan05218  Melanoma
ccan05220  Chronic myeloid leukemia
ccan05221  Acute myeloid leukemia
ccan05222  Small cell lung cancer
ccan05223  Non-small cell lung cancer
ccan05224  Breast cancer
ccan05225  Hepatocellular carcinoma
ccan05226  Gastric cancer
ccan05230  Central carbon metabolism in cancer
ccan05231  Choline metabolism in cancer
ccan05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ccan05415  Diabetic cardiomyopathy
ccan05417  Lipid and atherosclerosis
ccan05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109686235 (Akt3)
   04012 ErbB signaling pathway
    109686235 (Akt3)
   04014 Ras signaling pathway
    109686235 (Akt3)
   04015 Rap1 signaling pathway
    109686235 (Akt3)
   04370 VEGF signaling pathway
    109686235 (Akt3)
   04371 Apelin signaling pathway
    109686235 (Akt3)
   04630 JAK-STAT signaling pathway
    109686235 (Akt3)
   04668 TNF signaling pathway
    109686235 (Akt3)
   04066 HIF-1 signaling pathway
    109686235 (Akt3)
   04068 FoxO signaling pathway
    109686235 (Akt3)
   04072 Phospholipase D signaling pathway
    109686235 (Akt3)
   04071 Sphingolipid signaling pathway
    109686235 (Akt3)
   04024 cAMP signaling pathway
    109686235 (Akt3)
   04022 cGMP-PKG signaling pathway
    109686235 (Akt3)
   04151 PI3K-Akt signaling pathway
    109686235 (Akt3)
   04152 AMPK signaling pathway
    109686235 (Akt3)
   04150 mTOR signaling pathway
    109686235 (Akt3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    109686235 (Akt3)
   04518 Integrin signaling
    109686235 (Akt3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109686235 (Akt3)
  09143 Cell growth and death
   04210 Apoptosis
    109686235 (Akt3)
   04218 Cellular senescence
    109686235 (Akt3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109686235 (Akt3)
   04550 Signaling pathways regulating pluripotency of stem cells
    109686235 (Akt3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109686235 (Akt3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109686235 (Akt3)
   04613 Neutrophil extracellular trap formation
    109686235 (Akt3)
   04620 Toll-like receptor signaling pathway
    109686235 (Akt3)
   04625 C-type lectin receptor signaling pathway
    109686235 (Akt3)
   04660 T cell receptor signaling pathway
    109686235 (Akt3)
   04662 B cell receptor signaling pathway
    109686235 (Akt3)
   04664 Fc epsilon RI signaling pathway
    109686235 (Akt3)
   04666 Fc gamma R-mediated phagocytosis
    109686235 (Akt3)
   04062 Chemokine signaling pathway
    109686235 (Akt3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109686235 (Akt3)
   04922 Glucagon signaling pathway
    109686235 (Akt3)
   04923 Regulation of lipolysis in adipocytes
    109686235 (Akt3)
   04920 Adipocytokine signaling pathway
    109686235 (Akt3)
   04929 GnRH secretion
    109686235 (Akt3)
   04915 Estrogen signaling pathway
    109686235 (Akt3)
   04914 Progesterone-mediated oocyte maturation
    109686235 (Akt3)
   04917 Prolactin signaling pathway
    109686235 (Akt3)
   04926 Relaxin signaling pathway
    109686235 (Akt3)
   04935 Growth hormone synthesis, secretion and action
    109686235 (Akt3)
   04919 Thyroid hormone signaling pathway
    109686235 (Akt3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109686235 (Akt3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109686235 (Akt3)
  09156 Nervous system
   04725 Cholinergic synapse
    109686235 (Akt3)
   04728 Dopaminergic synapse
    109686235 (Akt3)
   04722 Neurotrophin signaling pathway
    109686235 (Akt3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109686235 (Akt3)
  09149 Aging
   04211 Longevity regulating pathway
    109686235 (Akt3)
   04213 Longevity regulating pathway - multiple species
    109686235 (Akt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109686235 (Akt3)
   05205 Proteoglycans in cancer
    109686235 (Akt3)
   05207 Chemical carcinogenesis - receptor activation
    109686235 (Akt3)
   05208 Chemical carcinogenesis - reactive oxygen species
    109686235 (Akt3)
   05230 Central carbon metabolism in cancer
    109686235 (Akt3)
   05231 Choline metabolism in cancer
    109686235 (Akt3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109686235 (Akt3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109686235 (Akt3)
   05212 Pancreatic cancer
    109686235 (Akt3)
   05225 Hepatocellular carcinoma
    109686235 (Akt3)
   05226 Gastric cancer
    109686235 (Akt3)
   05214 Glioma
    109686235 (Akt3)
   05221 Acute myeloid leukemia
    109686235 (Akt3)
   05220 Chronic myeloid leukemia
    109686235 (Akt3)
   05218 Melanoma
    109686235 (Akt3)
   05211 Renal cell carcinoma
    109686235 (Akt3)
   05215 Prostate cancer
    109686235 (Akt3)
   05213 Endometrial cancer
    109686235 (Akt3)
   05224 Breast cancer
    109686235 (Akt3)
   05222 Small cell lung cancer
    109686235 (Akt3)
   05223 Non-small cell lung cancer
    109686235 (Akt3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109686235 (Akt3)
   05170 Human immunodeficiency virus 1 infection
    109686235 (Akt3)
   05161 Hepatitis B
    109686235 (Akt3)
   05160 Hepatitis C
    109686235 (Akt3)
   05164 Influenza A
    109686235 (Akt3)
   05162 Measles
    109686235 (Akt3)
   05168 Herpes simplex virus 1 infection
    109686235 (Akt3)
   05163 Human cytomegalovirus infection
    109686235 (Akt3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109686235 (Akt3)
   05169 Epstein-Barr virus infection
    109686235 (Akt3)
   05165 Human papillomavirus infection
    109686235 (Akt3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109686235 (Akt3)
   05135 Yersinia infection
    109686235 (Akt3)
   05152 Tuberculosis
    109686235 (Akt3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109686235 (Akt3)
   05142 Chagas disease
    109686235 (Akt3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109686235 (Akt3)
   05017 Spinocerebellar ataxia
    109686235 (Akt3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    109686235 (Akt3)
   05418 Fluid shear stress and atherosclerosis
    109686235 (Akt3)
   05415 Diabetic cardiomyopathy
    109686235 (Akt3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    109686235 (Akt3)
   04932 Non-alcoholic fatty liver disease
    109686235 (Akt3)
   04931 Insulin resistance
    109686235 (Akt3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109686235 (Akt3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109686235 (Akt3)
   01524 Platinum drug resistance
    109686235 (Akt3)
   01522 Endocrine resistance
    109686235 (Akt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109686235 (Akt3)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109686235 (Akt3)
Protein kinases [BR:ccan01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   109686235 (Akt3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like FTA2 ABC1
Other DBs
NCBI-GeneID: 109686235
NCBI-ProteinID: XP_020019049
UniProt: A0A8B7UJ79
LinkDB
Position
Unknown
AA seq 416 aa
GNRKATEKSRKQSQDPSPAPRERGEVKDTNTREEWTEAIQAVADRLQRQEEERMNCSPTS
QIDNAGEEEMDASTSHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEV
IIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVF
SEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATM
KTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDI
KFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFK
PQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
NT seq 1251 nt   +upstreamnt  +downstreamnt
ggaaacagaaaagcaacagagaaaagcagaaaacaatcccaagacccgtccccagctccc
agggaaaggggagaagttaaagacacaaacacaagggaagaatggacagaagctatccag
gctgtggcagacagactgcagaggcaagaagaggagagaatgaactgtagtccaacttct
caaattgacaatgcaggagaggaagagatggacgcttctacaagtcaccacaaaagaaag
acaatgaatgattttgactatttgaaactactaggtaaaggcacttttgggaaagttatt
ttggttcgagagaaggcaagtgggaaatactacgccatgaagattctgaagaaggaagtc
atcattgcaaaggatgaagtggcacacactctaactgaaagcagagtactaaagaatacc
aggcatccatttttaacatccttgaaatattccttccagacaaaagaccgtttgtgtttt
gtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagagcgcgtgttc
tctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggactatctgcat
tctgggaagattgtgtaccgtgatctcaagttggagaatttgatgctggataaagatggc
catataaaaattacagattttggactttgcaaagaaggaatcacagatgcagcaaccatg
aagacattctgtggtacaccagagtatctggcaccagaggtgttagaagataatgactat
ggccgagcagtagactggtggggcctaggggttgtcatgtatgagatgatgtgtgggagg
ttacctttctacaaccaggaccatgagaaactgtttgaactaatacttatggaagacatt
aaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctcttgataaag
gatccaaataaacgccttggtggaggaccagatgatgcaaaagaaatcatgaggcacagc
ttcttctctggagtgaattggcaagatgtgtatgacaaaaagcttgtacctcccttcaag
cctcaagtaacatctgagaccgataccagatattttgatgaagaattcacagctcagact
attacaataacaccacctgaaaaatatgacgaggatggcatggactgcgtggacaacgag
aggcggccgcacttccctcagttctcctactccgcaagtggacgagaatag

DBGET integrated database retrieval system