Castor canadensis (American beaver): 109686801 Help Entry 109686801         CDS       T04791                                  Symbol Urm1 Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism ccan  Castor canadensis (American beaver) Pathway ccan04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     109686801 (Urm1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:ccan03016]     109686801 (Urm1)    04121 Ubiquitin system [BR:ccan04121]     109686801 (Urm1) Transfer RNA biogenesis [BR:ccan03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     109686801 (Urm1) Ubiquitin system [BR:ccan04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    109686801 (Urm1) SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  109686801 NCBI-ProteinID:  XP_020019903 UniProt:  A0A250Y8V4 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MAAPLSVEVEFGGGAELLFDGVKKHQVTLPGQEEPWDIRNLLVWIKKNLLKERPELFLQG DSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcagcgcccttgtcagtggaggtggagttcggaggcggtgcggagctactgtttgac ggagtaaaaaagcatcaagtcaccttgcctgggcaggaagaaccctgggatatccggaac ctccttgtctggatcaagaagaatttgttgaaagagcggccagagctattcctccaggga gacagcgtgcggccaggaattctggtgctgattaatgatgccgactgggaactgctgggt gagctggactaccagctgcaggaccaggacagcgtactcttcatttccacgctgcatgga ggctga

DBGET integrated database retrieval system