Castor canadensis (American beaver): 109686941 Help Entry 109686941         CDS       T04791                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism ccan  Castor canadensis (American beaver) Pathway ccan03272   Virion - Hepatitis viruses ccan04382   Cornified envelope formation ccan04514   Cell adhesion molecules ccan04530   Tight junction ccan04670   Leukocyte transendothelial migration ccan05160   Hepatitis C Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     109686941  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     109686941  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     109686941  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     109686941   09158 Development and regeneration    04382 Cornified envelope formation     109686941  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     109686941  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccan03037]     109686941    04147 Exosome [BR:ccan04147]     109686941    04515 Cell adhesion molecules [BR:ccan04515]     109686941 Cilium and associated proteins [BR:ccan03037]  Other cilia and associated proteins   Stereociliary proteins    109686941 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    109686941   Exosomal proteins of colorectal cancer cells    109686941 Cell adhesion molecules [BR:ccan04515]  Immunoglobulin superfamily   L1 family    109686941 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin TMEM37 Claudin_2 Motif Other DBs NCBI-GeneID:  109686941 NCBI-ProteinID:  XP_020020106 UniProt:  A0A8B7UKG1 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search MASMRPQVTGIALAVLGRLGAILSCALPMWRVTSLMNSDIHEAEFVSEGLWKVCNILNTT QIQCAKHKSLLYVPDDLLVARLLVVTCIIVTALGLLFSVVGDKCSKWVDDETINAKIMTK AGLMLLMSGLW NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcttccatgaggccacaggtgacaggcattgccctggccgtgctgggtcggctgggt gccattctgagctgtgcactgcccatgtggagggtgacatccttgatgaacagtgacatc catgaagctgagtttgtgtcggagggcttgtggaaggtctgcaatattctgaacacaacc cagattcaatgcgcaaaacacaagtcactgctatatgtgccagacgaccttttggtggct cgccttctcgtggtcacctgcatcattgtgactgcgctgggtttgctgttctccgtggtg ggggacaagtgcagcaagtgggtggacgatgagaccatcaatgccaagatcatgaccaag gctggtctgatgctcctgatgtcaggtttatggtga

DBGET integrated database retrieval system