Castor canadensis (American beaver): 109687021 Help Entry 109687021         CDS       T04791                                  Symbol Ccl22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism ccan  Castor canadensis (American beaver) Pathway ccan04060   Cytokine-cytokine receptor interaction ccan04061   Viral protein interaction with cytokine and cytokine receptor ccan04062   Chemokine signaling pathway ccan04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109687021 (Ccl22)    04061 Viral protein interaction with cytokine and cytokine receptor     109687021 (Ccl22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109687021 (Ccl22)    04062 Chemokine signaling pathway     109687021 (Ccl22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109687021 (Ccl22) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Chemokines    109687021 (Ccl22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  109687021 NCBI-ProteinID:  XP_020020246 UniProt:  A0A8B7UKV0 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MANLQGPLLAALILLSVVFPATNAGPYGINVEDSVCCRDYIRHTLPLTVVKRIYWTSDSC RRPGIVLQTFKDLEICANPRMPWVKRMLRKLG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggccaacctgcagggtccactcctggcagctctaatcctgctttcagtagtgtttcca gcaaccaatgcaggtccatatggcatcaacgtggaggacagcgtctgctgccgggactac atccgccacactctgcccctgactgtggtgaaacgtatctactggacctcggactcctgc cgtaggcctggcattgtcttgcaaaccttcaaggacctggagatctgtgccaaccccaga atgccttgggtgaagagaatgctccggaagctgggctaa

DBGET integrated database retrieval system