KEGG   Castor canadensis (American beaver): 109687703
Entry
109687703         CDS       T04791                                 
Symbol
Mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04927  Cortisol synthesis and secretion
ccan04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    109687703 (Mrap)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109687703 (Mrap)
SSDB
Motif
Pfam: MRAP FixQ EVC2_like
Other DBs
NCBI-GeneID: 109687703
NCBI-ProteinID: XP_020021280
UniProt: A0A8B7USQ5
LinkDB
Position
Unknown
AA seq 111 aa
MINRTNISVPYYSYEYYLDYLDLIPVDEKKLKANKHFIVIAFWVSLAAFVVILFLILLYT
SWPGSLQMRRNSQHHQTCPWSHSLNLSSCLRRTSQGTAVEPGSGGGVDQRL
NT seq 336 nt   +upstreamnt  +downstreamnt
atgatcaacaggaccaacatctctgttccgtactacagctatgaatactacctagactac
ttggacctcattcctgtggatgagaagaagctaaaagccaacaaacatttcatcgtcatc
gccttctgggtgagcctggcagcttttgtggtcatcctcttcctcattctgctgtatacg
tcctggccaggctccctgcagatgaggaggaactcccagcaccaccaaacgtgcccatgg
agtcacagtctcaacctttcctcctgcctccggaggacctcccaggggacagcagtggaa
cctggaagtggaggtggtgttgaccagaggctatag

DBGET integrated database retrieval system