Castor canadensis (American beaver): 109687731 Help Entry 109687731         CDS       T04791                                  Symbol Mycbp Name (RefSeq) C-Myc-binding protein   KO K25550   c-Myc-binding protein Organism ccan  Castor canadensis (American beaver) Brite KEGG Orthology (KO) [BR:ccan00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccan03037]     109687731 (Mycbp) Cilium and associated proteins [BR:ccan03037]  Motile cilia and associated proteins   Sperm associated proteins    109687731 (Mycbp) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TSC22 ZapB Motif Other DBs NCBI-GeneID:  109687731 NCBI-ProteinID:  XP_020021321 UniProt:  A0A8B7UNW1 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search GITGVSHWCPEKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYE ATVEENKKLKAKLAQYEPPQEEKRAE NT seq 262 nt NT seq  +upstreamnt  +downstreamnt tgggattacaggtgtgagccactggtgcccagaaaaagtgttggtagccttatatgaaga accagagaaacctaatagtgctttggattttttaaagcatcacttaggagctgctacgcc ggaaaatccagaaatagagctgcttcgcctagaattggcagaaatgaaagaaaaatatga agctactgtagaagaaaataaaaaactgaaagcaaagcttgctcagtatgaaccacctca ggaggagaagcgtgctgaatag

DBGET integrated database retrieval system