Castor canadensis (American beaver): 109687752 Help Entry 109687752         CDS       T04791                                  Symbol Ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism ccan  Castor canadensis (American beaver) Brite KEGG Orthology (KO) [BR:ccan00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:ccan03041]     109687752 (Ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109687752 (Ubl5) Spliceosome [BR:ccan03041]  Complex B   Other components    Complex B specific factors     109687752 (Ubl5) Cytokines and neuropeptides [BR:ccan04052]  Neuropeptides   Unclassified    109687752 (Ubl5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  109687752 NCBI-ProteinID:  XP_020021360 UniProt:  A0A250XUE4 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctggggaagaaagtccgcgtcaagtgcaacacc gatgacaccatcggggacctcaagaaactgatcgcggcccaaactggcacccgttggaac aagattgtccttaagaagtggtacacgatctttaaggaccatgtatcgctgggggactat gaaatccatgatgggatgaacctggaactttattatcagtag

DBGET integrated database retrieval system