Castor canadensis (American beaver): 109688957 Help Entry 109688957         CDS       T04791                                  Name (RefSeq) interferon alpha-21-like   KO K05414   interferon alpha Organism ccan  Castor canadensis (American beaver) Pathway ccan04060   Cytokine-cytokine receptor interaction ccan04151   PI3K-Akt signaling pathway ccan04217   Necroptosis ccan04620   Toll-like receptor signaling pathway ccan04621   NOD-like receptor signaling pathway ccan04622   RIG-I-like receptor signaling pathway ccan04623   Cytosolic DNA-sensing pathway ccan04630   JAK-STAT signaling pathway ccan04650   Natural killer cell mediated cytotoxicity ccan04936   Alcoholic liver disease ccan05152   Tuberculosis ccan05160   Hepatitis C ccan05161   Hepatitis B ccan05162   Measles ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05165   Human papillomavirus infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05168   Herpes simplex virus 1 infection ccan05169   Epstein-Barr virus infection ccan05170   Human immunodeficiency virus 1 infection ccan05171   Coronavirus disease - COVID-19 ccan05200   Pathways in cancer ccan05320   Autoimmune thyroid disease ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109688957    04151 PI3K-Akt signaling pathway     109688957   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109688957  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109688957  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109688957    04621 NOD-like receptor signaling pathway     109688957    04622 RIG-I-like receptor signaling pathway     109688957    04623 Cytosolic DNA-sensing pathway     109688957    04650 Natural killer cell mediated cytotoxicity     109688957  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109688957   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109688957    05161 Hepatitis B     109688957    05160 Hepatitis C     109688957    05171 Coronavirus disease - COVID-19     109688957    05164 Influenza A     109688957    05162 Measles     109688957    05168 Herpes simplex virus 1 infection     109688957    05163 Human cytomegalovirus infection     109688957    05167 Kaposi sarcoma-associated herpesvirus infection     109688957    05169 Epstein-Barr virus infection     109688957    05165 Human papillomavirus infection     109688957   09171 Infectious disease: bacterial    05152 Tuberculosis     109688957   09163 Immune disease    05320 Autoimmune thyroid disease     109688957   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109688957   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     109688957  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109688957 Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Interferons    109688957 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon CoV_NSP2_N STX6_10_61_N Motif Other DBs NCBI-GeneID:  109688957 NCBI-ProteinID:  XP_020023202 UniProt:  A0A8B7UVM6 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MALSFALLMALVVLRCKSECSLDCDLPQTHTLGSRRALILLGQMRRISPFSCMKDRNDFG LPQKEFVGKQDKKIQAISVLHEMTKQIYNLFSTKDSSAAWAKTLLHKFCTGLSQQLKDLE ACLTHEVGEEEPSLIHENSTLAVKKYFQRIALYLKGKKYSPCAWEVVRSEIMRAFSLSTN LQERLRNEE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtcctttgctttactaatggccctggtggtgctcagatgcaagtcagagtgt tccctggactgtgacctgcctcaaactcatacccttggtagcaggagggctttgatactc ctgggacaaatgaggagaatctctcctttctcctgcatgaaggatagaaatgactttgga cttccccagaaggagtttgttggaaagcaggacaagaagattcaagctatctctgtcctc catgagatgaccaagcagatctacaacctcttcagcacaaaggactcctctgctgcttgg gcaaagacccttctgcacaaattctgcactggcctttctcaacagctgaaagacctggaa gcctgtctgacacacgaggtgggggaggaagaaccttccctgatacatgagaactccaca ctggctgtgaagaaatacttccaaaggatagctctctacctgaaagggaagaaatacagt ccttgtgcctgggaggttgtcagatcagaaatcatgagagccttctctttatcaacaaac ttgcaagaaagattaaggaatgaggaatga

DBGET integrated database retrieval system