Castor canadensis (American beaver): 109688959 Help Entry 109688959         CDS       T04791                                  Symbol Ghrl Name (RefSeq) appetite-regulating hormone   KO K05254   ghrelin Organism ccan  Castor canadensis (American beaver) Pathway ccan04024   cAMP signaling pathway ccan04080   Neuroactive ligand-receptor interaction ccan04081   Hormone signaling ccan04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     109688959 (Ghrl)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     109688959 (Ghrl)    04081 Hormone signaling     109688959 (Ghrl)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     109688959 (Ghrl)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109688959 (Ghrl) Cytokines and neuropeptides [BR:ccan04052]  Neuropeptides   GPCR binding    109688959 (Ghrl) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Motilin_assoc Motilin_ghrelin Motif Other DBs NCBI-GeneID:  109688959 NCBI-ProteinID:  XP_020023169 UniProt:  A0A8B7UW42 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MLSAGTICSLLLLSVFWVDLAMAGSSFLSPKHQKVQQRKDSKKLPAKLQPRALEGWLRPE DRGQTEEEEDELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEAKGESMPRSR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgctctctgcggggaccatctgcagcttgctgctcctcagtgtgttctgggtggacttg gccatggcaggctccagcttcctgagccccaaacatcagaaagtccagcagagaaaggac tccaagaagctaccggccaaactccagcctcgggctctggaaggctggctccgcccggag gacagagggcagacagaagaggaagaggacgagctggagatccggttcaatgcccccttt gacgttggcatcaagctgtcaggagctcagtaccagcaacatggccgggccctggggaag tttcttcaggacatactttgggaagaggccaaaggtgagtccatgcccaggtcacgttaa

DBGET integrated database retrieval system