Castor canadensis (American beaver): 109689243 Help Entry 109689243         CDS       T04791                                  Symbol Csta Name (RefSeq) cystatin-A   KO K13907   cystatin-A/B Organism ccan  Castor canadensis (American beaver) Brite KEGG Orthology (KO) [BR:ccan00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ccan01002]     109689243 (Csta)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109689243 (Csta) Peptidases and inhibitors [BR:ccan01002]  Peptidase inhibitors   Family I25: cystatin family    109689243 (Csta) Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109689243 (Csta) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin SQAPI Afaf Dynein_light DUF7748 Motif Other DBs NCBI-GeneID:  109689243 NCBI-ProteinID:  XP_020023588 UniProt:  A0A8B7UVQ4 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MSDYTRMVPGGLSEARPATPEIQEIADKIKLQLEEKTNETYQEFKAVEYKTQVVAGTNFY IKIRVGDGEYIHVRVFRALPGQNKELELTGYETGKREDDELTGFHH NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgagcgattacaccaggatggtacctggaggcttgagtgaggcaagacctgccactcca gaaatccaggagattgctgataagattaaactacagcttgaagaaaaaacaaatgagacc taccaagaatttaaagctgtagaatataaaactcaagtagttgctggaactaatttttac attaagataagagtaggtgatggtgaatatattcatgtgagagtattcagagctcttcct ggacaaaataaggagttggaacttactggttatgagacaggcaaacgtgaagatgacgag ctgactggctttcaccactga

DBGET integrated database retrieval system