Castor canadensis (American beaver): 109691487 Help Entry 109691487         CDS       T04791                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism ccan  Castor canadensis (American beaver) Pathway ccan04613   Neutrophil extracellular trap formation ccan05034   Alcoholism ccan05202   Transcriptional misregulation in cancer ccan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccan00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109691487  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     109691487   09163 Immune disease    05322 Systemic lupus erythematosus     109691487   09165 Substance dependence    05034 Alcoholism     109691487  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccan03036]     109691487   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109691487 Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109691487 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109691487 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  109691487 NCBI-ProteinID:  XP_020027103 UniProt:  A0A250Y9U3 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtactaagcagaccgcccgcaaatccaccggtggtaaagcgcccaggaaacaa ctggctacaaaagccgctcgcaagagcgcgccctctaccggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgctatcagaagtccaccgaa cttctgattcgcaaactccccttccaacgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagataccaacctgtgtgctatccatgccaaacgtgtgacaatt atgccaaaagacatccagctagcacgccgcatacgtggagagcgtgcttaa

DBGET integrated database retrieval system