Castor canadensis (American beaver): 109691766 Help Entry 109691766         CDS       T04791                                  Symbol Bcl2l1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ccan  Castor canadensis (American beaver) Pathway ccan01521   EGFR tyrosine kinase inhibitor resistance ccan01524   Platinum drug resistance ccan04014   Ras signaling pathway ccan04064   NF-kappa B signaling pathway ccan04115   p53 signaling pathway ccan04137   Mitophagy - animal ccan04140   Autophagy - animal ccan04151   PI3K-Akt signaling pathway ccan04210   Apoptosis ccan04215   Apoptosis - multiple species ccan04621   NOD-like receptor signaling pathway ccan04630   JAK-STAT signaling pathway ccan05012   Parkinson disease ccan05014   Amyotrophic lateral sclerosis ccan05022   Pathways of neurodegeneration - multiple diseases ccan05145   Toxoplasmosis ccan05162   Measles ccan05166   Human T-cell leukemia virus 1 infection ccan05168   Herpes simplex virus 1 infection ccan05170   Human immunodeficiency virus 1 infection ccan05200   Pathways in cancer ccan05202   Transcriptional misregulation in cancer ccan05212   Pancreatic cancer ccan05220   Chronic myeloid leukemia ccan05222   Small cell lung cancer ccan05225   Hepatocellular carcinoma ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109691766 (Bcl2l1)    04630 JAK-STAT signaling pathway     109691766 (Bcl2l1)    04064 NF-kappa B signaling pathway     109691766 (Bcl2l1)    04151 PI3K-Akt signaling pathway     109691766 (Bcl2l1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109691766 (Bcl2l1)    04137 Mitophagy - animal     109691766 (Bcl2l1)   09143 Cell growth and death    04210 Apoptosis     109691766 (Bcl2l1)    04215 Apoptosis - multiple species     109691766 (Bcl2l1)    04115 p53 signaling pathway     109691766 (Bcl2l1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109691766 (Bcl2l1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109691766 (Bcl2l1)    05202 Transcriptional misregulation in cancer     109691766 (Bcl2l1)   09162 Cancer: specific types    05212 Pancreatic cancer     109691766 (Bcl2l1)    05225 Hepatocellular carcinoma     109691766 (Bcl2l1)    05220 Chronic myeloid leukemia     109691766 (Bcl2l1)    05222 Small cell lung cancer     109691766 (Bcl2l1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109691766 (Bcl2l1)    05170 Human immunodeficiency virus 1 infection     109691766 (Bcl2l1)    05162 Measles     109691766 (Bcl2l1)    05168 Herpes simplex virus 1 infection     109691766 (Bcl2l1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109691766 (Bcl2l1)   09164 Neurodegenerative disease    05012 Parkinson disease     109691766 (Bcl2l1)    05014 Amyotrophic lateral sclerosis     109691766 (Bcl2l1)    05022 Pathways of neurodegeneration - multiple diseases     109691766 (Bcl2l1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109691766 (Bcl2l1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109691766 (Bcl2l1)    01524 Platinum drug resistance     109691766 (Bcl2l1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccan01009]     109691766 (Bcl2l1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccan03036]     109691766 (Bcl2l1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ccan02000]     109691766 (Bcl2l1) Protein phosphatases and associated proteins [BR:ccan01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      109691766 (Bcl2l1) Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     109691766 (Bcl2l1) Transporters [BR:ccan02000]  Other transporters   Pores ion channels [TC:1]    109691766 (Bcl2l1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  109691766 NCBI-ProteinID:  XP_020027554 UniProt:  A0A250YD48 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGIESEVETPSAINGNPSWHLV DSPAVNGATGHSSSLDAREVIPMTAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaataggactgaggccccagaaggg attgaatcagaggtggagacccccagtgccatcaatggcaacccatcctggcacctggtg gacagccccgcagtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatgacagcagtgaagcaagcgctgagggaggcaggtgacgagtttgaactgcgg taccggcgggcattcagtgacctgacatcccagctccacataaccccggggacagcatat cagagctttgaacaggtagtgaacgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaagttggatggctacttacctgaatgaccacctagaacct tggatccaggagaacggcggctgggacacttttgtggaactctatggaaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system