Castor canadensis (American beaver): 109691916 Help Entry 109691916         CDS       T04791                                  Symbol Il2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism ccan  Castor canadensis (American beaver) Pathway ccan04060   Cytokine-cytokine receptor interaction ccan04061   Viral protein interaction with cytokine and cytokine receptor ccan04151   PI3K-Akt signaling pathway ccan04625   C-type lectin receptor signaling pathway ccan04630   JAK-STAT signaling pathway ccan04658   Th1 and Th2 cell differentiation ccan04659   Th17 cell differentiation ccan04660   T cell receptor signaling pathway ccan04672   Intestinal immune network for IgA production ccan04940   Type I diabetes mellitus ccan05135   Yersinia infection ccan05142   Chagas disease ccan05162   Measles ccan05166   Human T-cell leukemia virus 1 infection ccan05171   Coronavirus disease - COVID-19 ccan05200   Pathways in cancer ccan05320   Autoimmune thyroid disease ccan05321   Inflammatory bowel disease ccan05330   Allograft rejection ccan05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109691916 (Il2)    04151 PI3K-Akt signaling pathway     109691916 (Il2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109691916 (Il2)    04061 Viral protein interaction with cytokine and cytokine receptor     109691916 (Il2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109691916 (Il2)    04660 T cell receptor signaling pathway     109691916 (Il2)    04658 Th1 and Th2 cell differentiation     109691916 (Il2)    04659 Th17 cell differentiation     109691916 (Il2)    04672 Intestinal immune network for IgA production     109691916 (Il2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109691916 (Il2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109691916 (Il2)    05171 Coronavirus disease - COVID-19     109691916 (Il2)    05162 Measles     109691916 (Il2)   09171 Infectious disease: bacterial    05135 Yersinia infection     109691916 (Il2)   09174 Infectious disease: parasitic    05142 Chagas disease     109691916 (Il2)   09163 Immune disease    05320 Autoimmune thyroid disease     109691916 (Il2)    05321 Inflammatory bowel disease     109691916 (Il2)    05330 Allograft rejection     109691916 (Il2)    05332 Graft-versus-host disease     109691916 (Il2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109691916 (Il2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109691916 (Il2)    00536 Glycosaminoglycan binding proteins [BR:ccan00536]     109691916 (Il2) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Interleukins    109691916 (Il2) Glycosaminoglycan binding proteins [BR:ccan00536]  Heparan sulfate / Heparin   Cytokines    109691916 (Il2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 CA109-like Aromatic_hydrox Motif Other DBs NCBI-GeneID:  109691916 NCBI-ProteinID:  XP_020027786 UniProt:  A0A8C0X7V4 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MYKMQLLSCIALTFALVINSAPTSTSTKETQQQLEQLLLDLQMILKGVNNYKNPKLSRML TFKFYTPKKATELKHLQCLEEELKPLEEVLNLAQSKSFQLKDKRDLISNINVTVLKLKES EPPFMCEYDDETATIIEFLNKWITFCQTIISTLIR NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaatgcaactcttgtcttgcattgcactaacttttgcacttgtcataaacagt gcacccacttcaacctctacaaaggaaacacagcaacaactggagcaattactgctggac ttacagatgattctgaaaggagttaataattacaagaatcccaaactctccaggatgctc acttttaaattttacacacctaagaaggccacagaattaaaacatcttcagtgcctagaa gaagaactcaagcctctggaggaagtgctaaatttagctcagagcaaaagctttcaattg aaagataaaagggatttaatcagcaatatcaatgtaacagttctgaaactaaaggaatct gaaccaccattcatgtgcgaatatgatgatgaaacagcaacgatcattgaatttctaaac aaatggattaccttttgtcaaaccatcatctcaacactgattcgataa

DBGET integrated database retrieval system