Castor canadensis (American beaver): 109692199 Help Entry 109692199         CDS       T04791                                  Symbol Il12a Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism ccan  Castor canadensis (American beaver) Pathway ccan04060   Cytokine-cytokine receptor interaction ccan04620   Toll-like receptor signaling pathway ccan04622   RIG-I-like receptor signaling pathway ccan04625   C-type lectin receptor signaling pathway ccan04630   JAK-STAT signaling pathway ccan04658   Th1 and Th2 cell differentiation ccan04936   Alcoholic liver disease ccan04940   Type I diabetes mellitus ccan05133   Pertussis ccan05134   Legionellosis ccan05140   Leishmaniasis ccan05142   Chagas disease ccan05143   African trypanosomiasis ccan05144   Malaria ccan05145   Toxoplasmosis ccan05146   Amoebiasis ccan05152   Tuberculosis ccan05162   Measles ccan05164   Influenza A ccan05168   Herpes simplex virus 1 infection ccan05171   Coronavirus disease - COVID-19 ccan05200   Pathways in cancer ccan05321   Inflammatory bowel disease ccan05330   Allograft rejection ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109692199 (Il12a)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109692199 (Il12a)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109692199 (Il12a)    04622 RIG-I-like receptor signaling pathway     109692199 (Il12a)    04625 C-type lectin receptor signaling pathway     109692199 (Il12a)    04658 Th1 and Th2 cell differentiation     109692199 (Il12a)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109692199 (Il12a)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     109692199 (Il12a)    05164 Influenza A     109692199 (Il12a)    05162 Measles     109692199 (Il12a)    05168 Herpes simplex virus 1 infection     109692199 (Il12a)   09171 Infectious disease: bacterial    05133 Pertussis     109692199 (Il12a)    05134 Legionellosis     109692199 (Il12a)    05152 Tuberculosis     109692199 (Il12a)   09174 Infectious disease: parasitic    05146 Amoebiasis     109692199 (Il12a)    05144 Malaria     109692199 (Il12a)    05145 Toxoplasmosis     109692199 (Il12a)    05140 Leishmaniasis     109692199 (Il12a)    05142 Chagas disease     109692199 (Il12a)    05143 African trypanosomiasis     109692199 (Il12a)   09163 Immune disease    05321 Inflammatory bowel disease     109692199 (Il12a)    05330 Allograft rejection     109692199 (Il12a)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109692199 (Il12a)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109692199 (Il12a)    04936 Alcoholic liver disease     109692199 (Il12a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109692199 (Il12a)    00536 Glycosaminoglycan binding proteins [BR:ccan00536]     109692199 (Il12a) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Interleukins    109692199 (Il12a) Glycosaminoglycan binding proteins [BR:ccan00536]  Heparan sulfate / Heparin   Cytokines    109692199 (Il12a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 nSTAND3 Rh5 Motif Other DBs NCBI-GeneID:  109692199 NCBI-ProteinID:  XP_020028272 UniProt:  A0A250YCK2 LinkDB All DBs Position Unknown AA seq 219 aa AA seqDB search MRPARSLLLVATLVFLGHISLARHLPKATPVAGSFQCLNHSQNLLRAVSDALQKARQTLE FYSCTAEEIDHEDITKDKTSTVMACLPLELAKNESCLASRETVFITNENCLASGKTSFMM TLCLSSIYEDLKMYQMEFKAMNAKLLMDPKRQIFLDENMLATIDELMQALNSNSEMVPQK PSFEEPDFYKTKIKLCILLHAFRIRAVTIDRVMNYLNFS NT seq 660 nt NT seq  +upstreamnt  +downstreamnt atgcgtccagcgcgcagcctcctccttgtggccacccttgtcttcctgggccacatcagt ttggcaaggcacctccccaaggccacaccagttgcaggaagcttccagtgcctcaaccat tcccaaaacctgctaagagccgtcagtgatgctcttcaaaaggccagacaaaccctagaa ttttactcttgtactgctgaagagatcgatcatgaagatatcacgaaagacaaaaccagc acagtgatggcctgtttaccactggaactagccaagaatgagagttgcctggcttccagg gagactgttttcatcactaatgagaattgcctggcctctggaaagacctcttttatgatg accttgtgtcttagtagtatctatgaggacttgaagatgtaccaaatggagttcaaggcc atgaatgcaaagctgctgatggatcctaagaggcagatctttctagatgaaaacatgctg gcaactattgatgagctgatgcaggccctgaattccaacagtgagatggtgccacaaaaa ccttcctttgaagagccagatttttataaaaccaaaatcaagctctgcatacttcttcat gctttcagaattcgtgcagtgaccatcgacagagtgatgaattatctgaatttttcttaa

DBGET integrated database retrieval system