Castor canadensis (American beaver): 109692282 Help Entry 109692282         CDS       T04791                                  Symbol Nppc Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism ccan  Castor canadensis (American beaver) Pathway ccan04022   cGMP-PKG signaling pathway ccan04081   Hormone signaling ccan04270   Vascular smooth muscle contraction ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     109692282 (Nppc)   09133 Signaling molecules and interaction    04081 Hormone signaling     109692282 (Nppc)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     109692282 (Nppc)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109692282 (Nppc)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109692282 (Nppc) Cytokines and neuropeptides [BR:ccan04052]  Neuropeptides   Unclassified    109692282 (Nppc) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  109692282 NCBI-ProteinID:  XP_020028398 UniProt:  A0A8C0X2P2 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGALPKVPRTPPGEELAEPQAAGGGQKKSDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGANKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctcgcctgcgccctgctgctcacgctgctctctctccggccc tctgaagccaagcccggggcgctaccaaaggttccgcgaacccctccaggggaggagctg gctgagccccaagctgcgggcggcggtcagaagaagagcgataagactcccgggggcggt ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaaa tcgcgggcggcgtgggcccgccttctgcatgagcaccccaacgcgcgcaaatacaaagga gccaacaagaagggcttgtctaaaggctgtttcggcctcaagctggaccggatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system