Castor canadensis (American beaver): 109692646 Help Entry 109692646         CDS       T04791                                  Symbol Rab5a Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism ccan  Castor canadensis (American beaver) Pathway ccan04014   Ras signaling pathway ccan04137   Mitophagy - animal ccan04144   Endocytosis ccan04145   Phagosome ccan04148   Efferocytosis ccan04962   Vasopressin-regulated water reabsorption ccan05014   Amyotrophic lateral sclerosis ccan05022   Pathways of neurodegeneration - multiple diseases ccan05132   Salmonella infection ccan05146   Amoebiasis ccan05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109692646 (Rab5a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109692646 (Rab5a)    04145 Phagosome     109692646 (Rab5a)    04137 Mitophagy - animal     109692646 (Rab5a)    04148 Efferocytosis     109692646 (Rab5a)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     109692646 (Rab5a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109692646 (Rab5a)    05152 Tuberculosis     109692646 (Rab5a)   09174 Infectious disease: parasitic    05146 Amoebiasis     109692646 (Rab5a)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109692646 (Rab5a)    05022 Pathways of neurodegeneration - multiple diseases     109692646 (Rab5a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccan04131]     109692646 (Rab5a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109692646 (Rab5a)    04031 GTP-binding proteins [BR:ccan04031]     109692646 (Rab5a) Membrane trafficking [BR:ccan04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     109692646 (Rab5a)  Endosome - Lysosome transport     109692646 (Rab5a) Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109692646 (Rab5a)   Exosomal proteins of other body fluids (saliva and urine)    109692646 (Rab5a)   Exosomal proteins of colorectal cancer cells    109692646 (Rab5a)   Exosomal proteins of bladder cancer cells    109692646 (Rab5a) GTP-binding proteins [BR:ccan04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     109692646 (Rab5a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  109692646 NCBI-ProteinID:  XP_020028988 UniProt:  A0A250YCM1 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctcggagagtctgctgttggcaagtcaagccttgtgcttcgtttt gtgaaaggccagtttcatgaatttcaagagagtaccattggggctgcttttctaacccaa actgtgtgtcttgatgatacaacagtaaaatttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggtgcacaagcagccatagttgtgtat gatatcacaaatgaggagtcctttgcaagagcaaaaaactgggttaaagaacttcagagg caagcaagtcctaacattgtaatagctttatcaggaaacaaggctgacctagcaaacaaa agagctgtagatttccaggaagcacagtcttatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ctaccaaagaatgaaccacagaatccgggagcaaattctgctagaggaagaggagtagac cttactgaacctacacagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system