Castor canadensis (American beaver): 109693559 Help Entry 109693559         CDS       T04791                                  Symbol Mras Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism ccan  Castor canadensis (American beaver) Pathway ccan04010   MAPK signaling pathway ccan04014   Ras signaling pathway ccan04015   Rap1 signaling pathway ccan04072   Phospholipase D signaling pathway ccan04137   Mitophagy - animal ccan04140   Autophagy - animal ccan04218   Cellular senescence ccan04371   Apelin signaling pathway ccan04625   C-type lectin receptor signaling pathway ccan04810   Regulation of actin cytoskeleton ccan05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109693559 (Mras)    04014 Ras signaling pathway     109693559 (Mras)    04015 Rap1 signaling pathway     109693559 (Mras)    04371 Apelin signaling pathway     109693559 (Mras)    04072 Phospholipase D signaling pathway     109693559 (Mras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109693559 (Mras)    04137 Mitophagy - animal     109693559 (Mras)   09143 Cell growth and death    04218 Cellular senescence     109693559 (Mras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109693559 (Mras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109693559 (Mras)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     109693559 (Mras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ccan04031]     109693559 (Mras) GTP-binding proteins [BR:ccan04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109693559 (Mras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  109693559 NCBI-ProteinID:  XP_020030502 UniProt:  A0A250YC38 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNEW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDNAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcaaccagcgctgtccccagcgacaacctccccacatacaagctggtggtggtgggg gatggaggtgtgggcaagagtgccctcaccatccagttcttccagaagatctttgtacct gactacgaccccactatcgaggactcctacctgaaacacacagagattgacaatgaatgg gccatcctagacgttctggacacagccgggcaggaggagttcagcgccatgcgtgagcag tacatgcgcactggggacggcttcctcatcgtcttctccgtcaccgacaaggccagcttc gagcacgtggaccgcttccaccagctcatcctgcgagtcaaggatagggagtccttcccc atgatcctcgttgccaataaggtggacttgatgcacctgaggaaaatcaccagggagcaa ggaaaagaaatggcaaccaaacacaatattccgtacatagaaaccagcgccaaggaccca cctctcaacgtggacaacgccttccatgaccttgttagagtaattaggcaacagattcca gaaaaaagccagaagaagaagaagaaaaccaaatggcggggagaccgggccactggaact cacaaactgcagtgtgtgatcttgtga

DBGET integrated database retrieval system