Castor canadensis (American beaver): 109693681 Help Entry 109693681         CDS       T04791                                  Symbol Fgf22 Name (RefSeq) fibroblast growth factor 22   KO K04358   fibroblast growth factor Organism ccan  Castor canadensis (American beaver) Pathway ccan04010   MAPK signaling pathway ccan04014   Ras signaling pathway ccan04015   Rap1 signaling pathway ccan04020   Calcium signaling pathway ccan04151   PI3K-Akt signaling pathway ccan04810   Regulation of actin cytoskeleton ccan05200   Pathways in cancer ccan05207   Chemical carcinogenesis - receptor activation ccan05218   Melanoma ccan05224   Breast cancer ccan05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109693681 (Fgf22)    04014 Ras signaling pathway     109693681 (Fgf22)    04015 Rap1 signaling pathway     109693681 (Fgf22)    04020 Calcium signaling pathway     109693681 (Fgf22)    04151 PI3K-Akt signaling pathway     109693681 (Fgf22)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109693681 (Fgf22)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109693681 (Fgf22)    05207 Chemical carcinogenesis - receptor activation     109693681 (Fgf22)   09162 Cancer: specific types    05226 Gastric cancer     109693681 (Fgf22)    05218 Melanoma     109693681 (Fgf22)    05224 Breast cancer     109693681 (Fgf22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109693681 (Fgf22)    00536 Glycosaminoglycan binding proteins [BR:ccan00536]     109693681 (Fgf22) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Growth factors (RTK binding)    109693681 (Fgf22) Glycosaminoglycan binding proteins [BR:ccan00536]  Heparan sulfate / Heparin   Growth factors/receptors    109693681 (Fgf22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  109693681 NCBI-ProteinID:  XP_020030723 UniProt:  A0A8B7VGF3 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MRHRLWLGLAWLLLAREPGAAGTPSAPRRPRSYPHLEGDVRWRRLFSSTHFFLRVDSSGQ VQGTRWRHGQDSVVEIRSVHVGTVVIKAVYSGFYVAMNHRGRLYGSRVYTVDCRFRERIE ENGYNTYASLRWRHHGRPMFLALDGRGSPRQGGRTRRHHLSSHFLPVLVS NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgcgccaccgcctctggcttggcctggcctggctgctgctggcacgggagcccggtgcg gcagggaccccaagcgcgccgcggagaccgcgaagctacccgcacctggagggcgatgtg cgctggcggcgcctcttctcctccacccacttcttcctgcgcgtggactccagcggccag gtgcagggcacccgctggcgccacggccaggacagtgttgttgagatccgctccgttcac gtgggcactgtggtcatcaaggccgtgtactcaggcttctatgtggccatgaaccaccgg ggccgcctttacggatcgcgggtctacactgttgactgcaggttccgggagcgtattgaa gagaacggctacaatacctatgcctcgcttcgctggcgccaccatggtcggcccatgttc ctggcactggatggccggggatcaccccggcaaggtggccggacaaggcggcaccacctg tcttcccatttcctccctgtcctagtctcctga

DBGET integrated database retrieval system