Castor canadensis (American beaver): 109693708 Help Entry 109693708         CDS       T04791                                  Symbol Hmgb1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism ccan  Castor canadensis (American beaver) Pathway ccan03410   Base excision repair ccan04140   Autophagy - animal ccan04217   Necroptosis ccan04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     109693708 (Hmgb1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109693708 (Hmgb1)   09143 Cell growth and death    04217 Necroptosis     109693708 (Hmgb1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109693708 (Hmgb1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccan03036]     109693708 (Hmgb1)    03400 DNA repair and recombination proteins [BR:ccan03400]     109693708 (Hmgb1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109693708 (Hmgb1) Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     109693708 (Hmgb1) DNA repair and recombination proteins [BR:ccan03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      109693708 (Hmgb1)    MMR (mismatch excision repair)     Other MMR factors      109693708 (Hmgb1) Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109693708 (Hmgb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  109693708 NCBI-ProteinID:  XP_020030779 UniProt:  A0A250YCD0 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaagatgtcatcatatgcattcttcgtg caaacttgccgggaggagcacaagaagaagcaccccgacgcttcagtcaacttctcagag ttttctaagaagtgttcggagaggtggaagaccatgtctgctaaagagaaagggaaattt gaagacatggcaaaggcggacaaggctcgttatgaaagagaaatgaaaacttatattcct cctaaaggggagacgaaaaagaagttcaaagatcccaatgcacccaagaggcccccttcg gctttcttcttgttctgttctgagtatcgccccaaaatcaaaggtgagcatcccggcctg tccattggcgatgttgcaaagaagctgggagagatgtggaacaacactgctgcagatgac aagcagccttatgaaaagaaggcagccaagctgaaggaaaagtatgaaaaggatattgct gcctatcgagctaaaggaaaacctgatgcagcgaaaaagggagttgtcaaggctgaaaag agcaagaaaaagaaggaagaggaggaagatgaggaggacgaagaggatgaggaagaggag gaagacgaagaagatgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system