Castor canadensis (American beaver): 109693856 Help Entry 109693856         CDS       T04791                                  Symbol Myl5 Name (RefSeq) myosin light chain 5   KO K12753   myosin regulatory light chain 5 Organism ccan  Castor canadensis (American beaver) Pathway ccan04360   Axon guidance ccan04510   Focal adhesion ccan04520   Adherens junction ccan04670   Leukocyte transendothelial migration ccan04810   Regulation of actin cytoskeleton ccan04814   Motor proteins ccan04820   Cytoskeleton in muscle cells ccan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccan00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     109693856 (Myl5)    04520 Adherens junction     109693856 (Myl5)   09142 Cell motility    04814 Motor proteins     109693856 (Myl5)    04820 Cytoskeleton in muscle cells     109693856 (Myl5)    04810 Regulation of actin cytoskeleton     109693856 (Myl5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     109693856 (Myl5)   09158 Development and regeneration    04360 Axon guidance     109693856 (Myl5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109693856 (Myl5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccan04812]     109693856 (Myl5) Cytoskeleton proteins [BR:ccan04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      109693856 (Myl5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 Motif Other DBs NCBI-GeneID:  109693856 NCBI-ProteinID:  XP_020031036 UniProt:  A0A8B7VG98 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MVLPPQASRKTKKKESGVLCVQRASSNVFSNFKQTQIQVFKEAFTLMDQNQDGFIDKEDL KDTYASWVGKINVEDDKLEVMLKEASGPINFTMFLNLFGERLVSSWPFGRSGSPGSQFLT LRKPYFSHLSRSLSVTQRHTQPPTAKLLEASVLRSWSPSSQLQCWPAPLRTILNAFKMFK GKGSIHRE NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggttctcccacctcaggccagcaggaagacaaagaaaaaggaaagtggtgtcctgtgt gtccaaagggcatcctccaatgtcttctccaacttcaagcagacccagatccaagtgttc aaagaggcattcacactcatggatcagaaccaagatggcttcattgacaaggaggacctg aaggacacctatgcctcctgggtaggcaaaattaatgtggaggatgacaagctggaggtc atgcttaaggaggcctcagggcccattaacttcaccatgttcctgaacctgtttggggag agactggtgagctcctggcccttcggcaggagtggtagtcctggaagtcagttcctaaca cttagaaagccgtacttttcccatctctcaagaagcttatccgtgacccagaggcacact cagcctccaacagccaagctgttggaggcctctgtccttcgttcatggagccctagctct caattgcagtgctggcctgcccccttgagaaccatccttaatgcctttaagatgttcaaa ggcaaaggcagcatccacagggagtag

DBGET integrated database retrieval system