Castor canadensis (American beaver): 109695442 Help Entry 109695442         CDS       T04791                                  Symbol Rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism ccan  Castor canadensis (American beaver) Pathway ccan04010   MAPK signaling pathway ccan04014   Ras signaling pathway ccan04024   cAMP signaling pathway ccan04072   Phospholipase D signaling pathway ccan04137   Mitophagy - animal ccan04140   Autophagy - animal ccan04218   Cellular senescence ccan04371   Apelin signaling pathway ccan04625   C-type lectin receptor signaling pathway ccan04810   Regulation of actin cytoskeleton ccan05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109695442 (Rras2)    04014 Ras signaling pathway     109695442 (Rras2)    04371 Apelin signaling pathway     109695442 (Rras2)    04072 Phospholipase D signaling pathway     109695442 (Rras2)    04024 cAMP signaling pathway     109695442 (Rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109695442 (Rras2)    04137 Mitophagy - animal     109695442 (Rras2)   09143 Cell growth and death    04218 Cellular senescence     109695442 (Rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109695442 (Rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109695442 (Rras2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     109695442 (Rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109695442 (Rras2)    04031 GTP-binding proteins [BR:ccan04031]     109695442 (Rras2) Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109695442 (Rras2)   Exosomal proteins of bladder cancer cells    109695442 (Rras2) GTP-binding proteins [BR:ccan04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109695442 (Rras2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  109695442 NCBI-ProteinID:  XP_020033571 UniProt:  A0A250YC25 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE QECPPSPEPTRKEKDKKGCHCVIF NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggccgcggccggctggcgggacggctccggccaggagaagtaccgactcgtggtagtc ggcggaggcggcgtgggcaagtcggcgctcaccatccagttcatccagtcctattttgta acagattatgatccaaccattgaagattcctacacaaagcagtgtgtgatagatgacaga gctgcccgcctagatattttggatacagctggacaagaagaatttggagccatgcgagaa caatatatgaggactggcgagggcttcctgttggtcttttcagtcacagatagaggcagt tttgaagaaatttacaagtttcaaagacagattctcagagtaaaggatcgtgatgagttt ccaatgattttaattggtaataaagcagacctggatcatcaaagacaggtaacacaggaa gaaggacaacagttagcacggcagcttaaggtaacatacatggaggcatcagcaaagatt aggatgaatgtagatcaagctttccatgaacttgtccgggttataaggaaatttcaagag caagaatgtcctccttcaccagaaccaactcggaaagaaaaagacaagaaaggctgccat tgtgtaattttctaa

DBGET integrated database retrieval system