Castor canadensis (American beaver): 109697260 Help Entry 109697260         CDS       T04791                                  Symbol Nfkbia Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism ccan  Castor canadensis (American beaver) Pathway ccan04024   cAMP signaling pathway ccan04062   Chemokine signaling pathway ccan04064   NF-kappa B signaling pathway ccan04210   Apoptosis ccan04380   Osteoclast differentiation ccan04620   Toll-like receptor signaling pathway ccan04621   NOD-like receptor signaling pathway ccan04622   RIG-I-like receptor signaling pathway ccan04623   Cytosolic DNA-sensing pathway ccan04625   C-type lectin receptor signaling pathway ccan04657   IL-17 signaling pathway ccan04658   Th1 and Th2 cell differentiation ccan04659   Th17 cell differentiation ccan04660   T cell receptor signaling pathway ccan04662   B cell receptor signaling pathway ccan04668   TNF signaling pathway ccan04722   Neurotrophin signaling pathway ccan04920   Adipocytokine signaling pathway ccan04926   Relaxin signaling pathway ccan04931   Insulin resistance ccan04936   Alcoholic liver disease ccan05132   Salmonella infection ccan05134   Legionellosis ccan05135   Yersinia infection ccan05140   Leishmaniasis ccan05142   Chagas disease ccan05145   Toxoplasmosis ccan05160   Hepatitis C ccan05161   Hepatitis B ccan05162   Measles ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05166   Human T-cell leukemia virus 1 infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05168   Herpes simplex virus 1 infection ccan05169   Epstein-Barr virus infection ccan05170   Human immunodeficiency virus 1 infection ccan05171   Coronavirus disease - COVID-19 ccan05200   Pathways in cancer ccan05203   Viral carcinogenesis ccan05208   Chemical carcinogenesis - reactive oxygen species ccan05215   Prostate cancer ccan05220   Chronic myeloid leukemia ccan05222   Small cell lung cancer ccan05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     109697260 (Nfkbia)    04668 TNF signaling pathway     109697260 (Nfkbia)    04024 cAMP signaling pathway     109697260 (Nfkbia)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109697260 (Nfkbia)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109697260 (Nfkbia)    04621 NOD-like receptor signaling pathway     109697260 (Nfkbia)    04622 RIG-I-like receptor signaling pathway     109697260 (Nfkbia)    04623 Cytosolic DNA-sensing pathway     109697260 (Nfkbia)    04625 C-type lectin receptor signaling pathway     109697260 (Nfkbia)    04660 T cell receptor signaling pathway     109697260 (Nfkbia)    04658 Th1 and Th2 cell differentiation     109697260 (Nfkbia)    04659 Th17 cell differentiation     109697260 (Nfkbia)    04657 IL-17 signaling pathway     109697260 (Nfkbia)    04662 B cell receptor signaling pathway     109697260 (Nfkbia)    04062 Chemokine signaling pathway     109697260 (Nfkbia)   09152 Endocrine system    04920 Adipocytokine signaling pathway     109697260 (Nfkbia)    04926 Relaxin signaling pathway     109697260 (Nfkbia)   09156 Nervous system    04722 Neurotrophin signaling pathway     109697260 (Nfkbia)   09158 Development and regeneration    04380 Osteoclast differentiation     109697260 (Nfkbia)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109697260 (Nfkbia)    05208 Chemical carcinogenesis - reactive oxygen species     109697260 (Nfkbia)    05203 Viral carcinogenesis     109697260 (Nfkbia)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109697260 (Nfkbia)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     109697260 (Nfkbia)    05215 Prostate cancer     109697260 (Nfkbia)    05222 Small cell lung cancer     109697260 (Nfkbia)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109697260 (Nfkbia)    05170 Human immunodeficiency virus 1 infection     109697260 (Nfkbia)    05161 Hepatitis B     109697260 (Nfkbia)    05160 Hepatitis C     109697260 (Nfkbia)    05171 Coronavirus disease - COVID-19     109697260 (Nfkbia)    05164 Influenza A     109697260 (Nfkbia)    05162 Measles     109697260 (Nfkbia)    05168 Herpes simplex virus 1 infection     109697260 (Nfkbia)    05163 Human cytomegalovirus infection     109697260 (Nfkbia)    05167 Kaposi sarcoma-associated herpesvirus infection     109697260 (Nfkbia)    05169 Epstein-Barr virus infection     109697260 (Nfkbia)   09171 Infectious disease: bacterial    05132 Salmonella infection     109697260 (Nfkbia)    05135 Yersinia infection     109697260 (Nfkbia)    05134 Legionellosis     109697260 (Nfkbia)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109697260 (Nfkbia)    05140 Leishmaniasis     109697260 (Nfkbia)    05142 Chagas disease     109697260 (Nfkbia)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109697260 (Nfkbia)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     109697260 (Nfkbia)    04931 Insulin resistance     109697260 (Nfkbia)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ccan03000]     109697260 (Nfkbia)    04131 Membrane trafficking [BR:ccan04131]     109697260 (Nfkbia) Transcription factors [BR:ccan03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     109697260 (Nfkbia) Membrane trafficking [BR:ccan04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     109697260 (Nfkbia) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  109697260 NCBI-ProteinID:  XP_020036353 UniProt:  A0A250YF69 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPAEHAQEWAMEGLRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCTTQHLQSILQATN YNGHTCLHLASIHGYLGIVEHLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVFGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagccggccgagcacgcccaggagtgggccatggagggcctgcgggacggactg aagaaggagcggctgctggatgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgcgagatccgcctggagccgcaggaggcgccg cgcggcgccgagccctggaagcagcagctcaccgaagacggagactcgttcctgcacttg gccatcatccacgaagagaaggcactgaccatggaagtgattcgccaggtgaagggcgac ctggccttcctcaacttccagaacaatctgcagcagactccactccacttggctgtgatc accaaccagccagaaatcgcagaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggttgtctggccagtgta ggagtcctgacgcagacctgcacaacacagcaccttcagtccatcctgcaggccaccaac tacaatggccacacatgtctgcacttagcgtccatccatggctatctgggcatcgtggag catctggtgtctttgggtgctgatgtcaatgctcaggagccatgtaatggcaggacagcc ctccacctcgcagtggacctgcagaatcctgacctggtgtcgctcttgttgaagtgtggg gctgatgtcaacagagttacctaccaaggctactccccataccagctcacctggggccgc ccgagcacccggatacagcagcagctgggccagctcaccctggaaaatctccagatgctg cctgagagcgaggatgaagagagttatgacacagagtcagagttcacagaagatgagttg ccttatgatgactgtgtatttggaggccagcgcctgacattatga

DBGET integrated database retrieval system