Castor canadensis (American beaver): 109697466 Help Entry 109697466         CDS       T04791                                  Symbol Igf1 Name (RefSeq) insulin-like growth factor I   KO K05459   insulin-like growth factor 1 Organism ccan  Castor canadensis (American beaver) Pathway ccan01521   EGFR tyrosine kinase inhibitor resistance ccan01522   Endocrine resistance ccan04010   MAPK signaling pathway ccan04014   Ras signaling pathway ccan04015   Rap1 signaling pathway ccan04066   HIF-1 signaling pathway ccan04068   FoxO signaling pathway ccan04081   Hormone signaling ccan04114   Oocyte meiosis ccan04115   p53 signaling pathway ccan04150   mTOR signaling pathway ccan04151   PI3K-Akt signaling pathway ccan04152   AMPK signaling pathway ccan04211   Longevity regulating pathway ccan04213   Longevity regulating pathway - multiple species ccan04510   Focal adhesion ccan04550   Signaling pathways regulating pluripotency of stem cells ccan04730   Long-term depression ccan04750   Inflammatory mediator regulation of TRP channels ccan04913   Ovarian steroidogenesis ccan04914   Progesterone-mediated oocyte maturation ccan04935   Growth hormone synthesis, secretion and action ccan04960   Aldosterone-regulated sodium reabsorption ccan05200   Pathways in cancer ccan05202   Transcriptional misregulation in cancer ccan05205   Proteoglycans in cancer ccan05214   Glioma ccan05215   Prostate cancer ccan05218   Melanoma ccan05224   Breast cancer ccan05410   Hypertrophic cardiomyopathy ccan05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109697466 (Igf1)    04014 Ras signaling pathway     109697466 (Igf1)    04015 Rap1 signaling pathway     109697466 (Igf1)    04066 HIF-1 signaling pathway     109697466 (Igf1)    04068 FoxO signaling pathway     109697466 (Igf1)    04151 PI3K-Akt signaling pathway     109697466 (Igf1)    04152 AMPK signaling pathway     109697466 (Igf1)    04150 mTOR signaling pathway     109697466 (Igf1)   09133 Signaling molecules and interaction    04081 Hormone signaling     109697466 (Igf1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     109697466 (Igf1)    04115 p53 signaling pathway     109697466 (Igf1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     109697466 (Igf1)    04550 Signaling pathways regulating pluripotency of stem cells     109697466 (Igf1)  09150 Organismal Systems   09152 Endocrine system    04913 Ovarian steroidogenesis     109697466 (Igf1)    04914 Progesterone-mediated oocyte maturation     109697466 (Igf1)    04935 Growth hormone synthesis, secretion and action     109697466 (Igf1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     109697466 (Igf1)   09156 Nervous system    04730 Long-term depression     109697466 (Igf1)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     109697466 (Igf1)   09149 Aging    04211 Longevity regulating pathway     109697466 (Igf1)    04213 Longevity regulating pathway - multiple species     109697466 (Igf1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109697466 (Igf1)    05202 Transcriptional misregulation in cancer     109697466 (Igf1)    05205 Proteoglycans in cancer     109697466 (Igf1)   09162 Cancer: specific types    05214 Glioma     109697466 (Igf1)    05218 Melanoma     109697466 (Igf1)    05215 Prostate cancer     109697466 (Igf1)    05224 Breast cancer     109697466 (Igf1)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     109697466 (Igf1)    05414 Dilated cardiomyopathy     109697466 (Igf1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109697466 (Igf1)    01522 Endocrine resistance     109697466 (Igf1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109697466 (Igf1) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Growth factors (RTK binding)    109697466 (Igf1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  109697466 NCBI-ProteinID:  XP_020036677 UniProt:  A0A8C0WFE4 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MGKISSLPTQLFKCCFCDFLKVKIHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS VRAQRHTDVPKTQKSQPPPTNKKKKLQRRRKGGPKTRPGGEQQEGTEASQKKRKQERAEK GDWS NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgggaaaaatcagcagtcttccaactcaattatttaagtgctgcttttgtgatttcttg aaggtgaagatacacatcatgtcctcttcacatctcttctacctggccctctgcttgctc acctttaccagctctgccacagctggaccagagacactctgcggggctgagctggtagat gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacaggctatggc tccagcagtaggagggcacctcagacaggcatcgtggatgagtgctgcttccggagctgt gatctgaggaggttggagatgtattgtgcccctctcaaacctgccaagtcagcccgctct gtccgtgcccagcgccacactgacgtgcccaagactcaaaagtctcagcccccacctacc aacaagaaaaagaagcttcagaggagaaggaaaggtgggccaaagacacgcccaggaggg gaacaacaggaggggacagaagcaagtcagaagaagaggaaacaagaaagagcagagaag ggggactggagctag

DBGET integrated database retrieval system