Castor canadensis (American beaver): 109697844 Help Entry 109697844         CDS       T04791                                  Symbol Rhoa Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ccan  Castor canadensis (American beaver) Pathway ccan04014   Ras signaling pathway ccan04015   Rap1 signaling pathway ccan04022   cGMP-PKG signaling pathway ccan04024   cAMP signaling pathway ccan04062   Chemokine signaling pathway ccan04071   Sphingolipid signaling pathway ccan04072   Phospholipase D signaling pathway ccan04081   Hormone signaling ccan04144   Endocytosis ccan04150   mTOR signaling pathway ccan04270   Vascular smooth muscle contraction ccan04310   Wnt signaling pathway ccan04350   TGF-beta signaling pathway ccan04360   Axon guidance ccan04510   Focal adhesion ccan04517   IgSF CAM signaling ccan04520   Adherens junction ccan04530   Tight junction ccan04611   Platelet activation ccan04621   NOD-like receptor signaling pathway ccan04625   C-type lectin receptor signaling pathway ccan04660   T cell receptor signaling pathway ccan04670   Leukocyte transendothelial migration ccan04722   Neurotrophin signaling pathway ccan04810   Regulation of actin cytoskeleton ccan04921   Oxytocin signaling pathway ccan04928   Parathyroid hormone synthesis, secretion and action ccan04972   Pancreatic secretion ccan05100   Bacterial invasion of epithelial cells ccan05132   Salmonella infection ccan05133   Pertussis ccan05135   Yersinia infection ccan05152   Tuberculosis ccan05163   Human cytomegalovirus infection ccan05200   Pathways in cancer ccan05203   Viral carcinogenesis ccan05205   Proteoglycans in cancer ccan05206   MicroRNAs in cancer ccan05210   Colorectal cancer ccan05417   Lipid and atherosclerosis ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109697844 (Rhoa)    04015 Rap1 signaling pathway     109697844 (Rhoa)    04310 Wnt signaling pathway     109697844 (Rhoa)    04350 TGF-beta signaling pathway     109697844 (Rhoa)    04072 Phospholipase D signaling pathway     109697844 (Rhoa)    04071 Sphingolipid signaling pathway     109697844 (Rhoa)    04024 cAMP signaling pathway     109697844 (Rhoa)    04022 cGMP-PKG signaling pathway     109697844 (Rhoa)    04150 mTOR signaling pathway     109697844 (Rhoa)   09133 Signaling molecules and interaction    04081 Hormone signaling     109697844 (Rhoa)    04517 IgSF CAM signaling     109697844 (Rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109697844 (Rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     109697844 (Rhoa)    04520 Adherens junction     109697844 (Rhoa)    04530 Tight junction     109697844 (Rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109697844 (Rhoa)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     109697844 (Rhoa)    04621 NOD-like receptor signaling pathway     109697844 (Rhoa)    04625 C-type lectin receptor signaling pathway     109697844 (Rhoa)    04660 T cell receptor signaling pathway     109697844 (Rhoa)    04670 Leukocyte transendothelial migration     109697844 (Rhoa)    04062 Chemokine signaling pathway     109697844 (Rhoa)   09152 Endocrine system    04921 Oxytocin signaling pathway     109697844 (Rhoa)    04928 Parathyroid hormone synthesis, secretion and action     109697844 (Rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     109697844 (Rhoa)   09154 Digestive system    04972 Pancreatic secretion     109697844 (Rhoa)   09156 Nervous system    04722 Neurotrophin signaling pathway     109697844 (Rhoa)   09158 Development and regeneration    04360 Axon guidance     109697844 (Rhoa)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109697844 (Rhoa)    05206 MicroRNAs in cancer     109697844 (Rhoa)    05205 Proteoglycans in cancer     109697844 (Rhoa)    05203 Viral carcinogenesis     109697844 (Rhoa)   09162 Cancer: specific types    05210 Colorectal cancer     109697844 (Rhoa)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     109697844 (Rhoa)   09171 Infectious disease: bacterial    05132 Salmonella infection     109697844 (Rhoa)    05135 Yersinia infection     109697844 (Rhoa)    05133 Pertussis     109697844 (Rhoa)    05152 Tuberculosis     109697844 (Rhoa)    05100 Bacterial invasion of epithelial cells     109697844 (Rhoa)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109697844 (Rhoa)    05418 Fluid shear stress and atherosclerosis     109697844 (Rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccan04131]     109697844 (Rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109697844 (Rhoa)    04031 GTP-binding proteins [BR:ccan04031]     109697844 (Rhoa) Membrane trafficking [BR:ccan04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     109697844 (Rhoa) Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109697844 (Rhoa)   Exosomal proteins of other body fluids (saliva and urine)    109697844 (Rhoa)   Exosomal proteins of colorectal cancer cells    109697844 (Rhoa)   Exosomal proteins of bladder cancer cells    109697844 (Rhoa) GTP-binding proteins [BR:ccan04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     109697844 (Rhoa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  109697844 NCBI-ProteinID:  XP_020037312 UniProt:  A0A250YBM0 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcttgtggcaaaacatgc ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacggtgtttgag aactatgtggcagatattgaagtggatggaaaacaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcctgaggcccctctcttacccagacaccgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccagaagtcaagcatttctgtcccaacgtgcccatcattctggttgggaataagaaggat cttcggaatgatgagcacacaaggcgggagttagccaagatgaagcaggagccagtaaaa cctgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaaaaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system