Castor canadensis (American beaver): 109697910 Help Entry 109697910         CDS       T04791                                  Name (RefSeq) histone H2B type W-T-like   KO K11252   histone H2B Organism ccan  Castor canadensis (American beaver) Pathway ccan04613   Neutrophil extracellular trap formation ccan05034   Alcoholism ccan05203   Viral carcinogenesis ccan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccan00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109697910  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109697910   09163 Immune disease    05322 Systemic lupus erythematosus     109697910   09165 Substance dependence    05034 Alcoholism     109697910  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccan03036]     109697910   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109697910 Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109697910 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109697910 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_ABTB CBFD_NFYB_HMF TAF Motif Other DBs NCBI-GeneID:  109697910 NCBI-ProteinID:  XP_020037398 UniProt:  A0AC58LMF6 A0AC58LUD0 A0AC58LSY1 A0A8B7W139 A0AC58LMF9 A0AC58LSF5 A0A8B7W0J3 A0AC58LMF4 A0AC58LUC2 LinkDB All DBs Position Unknown AA seq 141 aa AA seqDB search MAERSLDKSTEPTSEMSAEEDLGPQETKGTDSTTQQTQEKPRCHRRPGRGGSFATYFPRV LKKFHQDLSLSQETAGVMDSFVHDMLDGIASEAGRLSRQANRSTITTWDIQRAVRLLLPG KVGSKVVYQAAGAMAMFTQRK NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggcagagcggagcttggacaagtcaaccgagccaacctctgagatgtctgctgaggag gaccttggtccccaggagaccaaggggacagactctacgacccagcagactcaggagaag ccaaggtgccaccgacgacccggccgtggtggcagctttgccacctatttcccccgggtg ctgaagaagtttcaccaggacctctccctgtcccaggagaccgcgggcgtcatggactcc ttcgtccatgacatgttggatggcatcgccagcgaggccggccgcctgtcccgccaagcc aaccgctcgaccatcaccacctgggacatccagagggccgtgcgcctcctgctgcccggg aaggtcggcagtaaagtggtgtaccaggccgccggcgccatggccatgttcacccagaga aagtga

DBGET integrated database retrieval system