Castor canadensis (American beaver): 109697970 Help Entry 109697970         CDS       T04791                                  Symbol Nxt1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism ccan  Castor canadensis (American beaver) Pathway ccan03008   Ribosome biogenesis in eukaryotes ccan03013   Nucleocytoplasmic transport ccan03015   mRNA surveillance pathway ccan05014   Amyotrophic lateral sclerosis ccan05164   Influenza A Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     109697970 (Nxt1)    03015 mRNA surveillance pathway     109697970 (Nxt1)    03008 Ribosome biogenesis in eukaryotes     109697970 (Nxt1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     109697970 (Nxt1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109697970 (Nxt1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ccan03019]     109697970 (Nxt1)    03009 Ribosome biogenesis [BR:ccan03009]     109697970 (Nxt1) Messenger RNA biogenesis [BR:ccan03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      109697970 (Nxt1) Ribosome biogenesis [BR:ccan03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     109697970 (Nxt1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NTF2 NXF_NTF2 Glyco_tran_10_N Cofilin_ADF Motif Other DBs NCBI-GeneID:  109697970 NCBI-ProteinID:  XP_020037474 UniProt:  A0A250YA24 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS PSNTVWKIASDCFRFQDWAS NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcatctgtggacttcaagacctatgtggatcaggcctgtagagctgctgaggagttt gtcaatgtctactatactaccatggataagcggcggcggctgctatcccgtctatacatg ggcacagccaccctggtatggaatggaaatgccgtgtcaggacaagaatccttgagcgag ttttttgaaatgttgccttccagtgagttccaaatcaacgtggtggactgccagcctgtt catgatgaagccacaccgagccagaccacagtccttgtcgtgatctgtgggacagtgaag tttgaaggcaacaaacagcgggacttcaaccagaacttcatcctgactgctcaagcctca cccagcaacacagtgtggaagatagcaagtgactgcttccggtttcaggactgggccagc tag

DBGET integrated database retrieval system