KEGG   Castor canadensis (American beaver): 109698042
Entry
109698042         CDS       T04791                                 
Symbol
Hras
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01521  EGFR tyrosine kinase inhibitor resistance
ccan01522  Endocrine resistance
ccan04010  MAPK signaling pathway
ccan04012  ErbB signaling pathway
ccan04014  Ras signaling pathway
ccan04015  Rap1 signaling pathway
ccan04062  Chemokine signaling pathway
ccan04068  FoxO signaling pathway
ccan04071  Sphingolipid signaling pathway
ccan04072  Phospholipase D signaling pathway
ccan04137  Mitophagy - animal
ccan04140  Autophagy - animal
ccan04144  Endocytosis
ccan04150  mTOR signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04210  Apoptosis
ccan04211  Longevity regulating pathway
ccan04213  Longevity regulating pathway - multiple species
ccan04218  Cellular senescence
ccan04360  Axon guidance
ccan04370  VEGF signaling pathway
ccan04371  Apelin signaling pathway
ccan04510  Focal adhesion
ccan04540  Gap junction
ccan04550  Signaling pathways regulating pluripotency of stem cells
ccan04625  C-type lectin receptor signaling pathway
ccan04630  JAK-STAT signaling pathway
ccan04650  Natural killer cell mediated cytotoxicity
ccan04660  T cell receptor signaling pathway
ccan04662  B cell receptor signaling pathway
ccan04664  Fc epsilon RI signaling pathway
ccan04714  Thermogenesis
ccan04720  Long-term potentiation
ccan04722  Neurotrophin signaling pathway
ccan04725  Cholinergic synapse
ccan04726  Serotonergic synapse
ccan04730  Long-term depression
ccan04810  Regulation of actin cytoskeleton
ccan04910  Insulin signaling pathway
ccan04912  GnRH signaling pathway
ccan04915  Estrogen signaling pathway
ccan04916  Melanogenesis
ccan04917  Prolactin signaling pathway
ccan04919  Thyroid hormone signaling pathway
ccan04921  Oxytocin signaling pathway
ccan04926  Relaxin signaling pathway
ccan04929  GnRH secretion
ccan04933  AGE-RAGE signaling pathway in diabetic complications
ccan04935  Growth hormone synthesis, secretion and action
ccan05010  Alzheimer disease
ccan05022  Pathways of neurodegeneration - multiple diseases
ccan05034  Alcoholism
ccan05132  Salmonella infection
ccan05160  Hepatitis C
ccan05161  Hepatitis B
ccan05163  Human cytomegalovirus infection
ccan05165  Human papillomavirus infection
ccan05166  Human T-cell leukemia virus 1 infection
ccan05167  Kaposi sarcoma-associated herpesvirus infection
ccan05170  Human immunodeficiency virus 1 infection
ccan05200  Pathways in cancer
ccan05203  Viral carcinogenesis
ccan05205  Proteoglycans in cancer
ccan05206  MicroRNAs in cancer
ccan05207  Chemical carcinogenesis - receptor activation
ccan05208  Chemical carcinogenesis - reactive oxygen species
ccan05210  Colorectal cancer
ccan05211  Renal cell carcinoma
ccan05213  Endometrial cancer
ccan05214  Glioma
ccan05215  Prostate cancer
ccan05216  Thyroid cancer
ccan05218  Melanoma
ccan05219  Bladder cancer
ccan05220  Chronic myeloid leukemia
ccan05221  Acute myeloid leukemia
ccan05223  Non-small cell lung cancer
ccan05224  Breast cancer
ccan05225  Hepatocellular carcinoma
ccan05226  Gastric cancer
ccan05230  Central carbon metabolism in cancer
ccan05231  Choline metabolism in cancer
ccan05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ccan05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109698042 (Hras)
   04015 Rap1 signaling pathway
    109698042 (Hras)
   04630 JAK-STAT signaling pathway
    109698042 (Hras)
   04068 FoxO signaling pathway
    109698042 (Hras)
   04072 Phospholipase D signaling pathway
    109698042 (Hras)
   04071 Sphingolipid signaling pathway
    109698042 (Hras)
   04151 PI3K-Akt signaling pathway
    109698042 (Hras)
   04150 mTOR signaling pathway
    109698042 (Hras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109698042 (Hras)
   04140 Autophagy - animal
    109698042 (Hras)
   04137 Mitophagy - animal
    109698042 (Hras)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109698042 (Hras)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109698042 (Hras)
   04660 T cell receptor signaling pathway
    109698042 (Hras)
   04662 B cell receptor signaling pathway
    109698042 (Hras)
   04664 Fc epsilon RI signaling pathway
    109698042 (Hras)
   04062 Chemokine signaling pathway
    109698042 (Hras)
  09152 Endocrine system
   04929 GnRH secretion
    109698042 (Hras)
   04915 Estrogen signaling pathway
    109698042 (Hras)
   04917 Prolactin signaling pathway
    109698042 (Hras)
   04921 Oxytocin signaling pathway
    109698042 (Hras)
   04926 Relaxin signaling pathway
    109698042 (Hras)
   04935 Growth hormone synthesis, secretion and action
    109698042 (Hras)
   04919 Thyroid hormone signaling pathway
    109698042 (Hras)
  09156 Nervous system
   04725 Cholinergic synapse
    109698042 (Hras)
   04726 Serotonergic synapse
    109698042 (Hras)
   04720 Long-term potentiation
    109698042 (Hras)
   04730 Long-term depression
    109698042 (Hras)
   04722 Neurotrophin signaling pathway
    109698042 (Hras)
  09158 Development and regeneration
   04360 Axon guidance
    109698042 (Hras)
  09149 Aging
   04211 Longevity regulating pathway
    109698042 (Hras)
   04213 Longevity regulating pathway - multiple species
    109698042 (Hras)
  09159 Environmental adaptation
   04714 Thermogenesis
    109698042 (Hras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109698042 (Hras)
   05206 MicroRNAs in cancer
    109698042 (Hras)
   05205 Proteoglycans in cancer
    109698042 (Hras)
   05207 Chemical carcinogenesis - receptor activation
    109698042 (Hras)
   05208 Chemical carcinogenesis - reactive oxygen species
    109698042 (Hras)
   05203 Viral carcinogenesis
    109698042 (Hras)
   05230 Central carbon metabolism in cancer
    109698042 (Hras)
   05231 Choline metabolism in cancer
    109698042 (Hras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109698042 (Hras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109698042 (Hras)
   05225 Hepatocellular carcinoma
    109698042 (Hras)
   05226 Gastric cancer
    109698042 (Hras)
   05214 Glioma
    109698042 (Hras)
   05216 Thyroid cancer
    109698042 (Hras)
   05221 Acute myeloid leukemia
    109698042 (Hras)
   05220 Chronic myeloid leukemia
    109698042 (Hras)
   05218 Melanoma
    109698042 (Hras)
   05211 Renal cell carcinoma
    109698042 (Hras)
   05219 Bladder cancer
    109698042 (Hras)
   05215 Prostate cancer
    109698042 (Hras)
   05213 Endometrial cancer
    109698042 (Hras)
   05224 Breast cancer
    109698042 (Hras)
   05223 Non-small cell lung cancer
    109698042 (Hras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109698042 (Hras)
   05170 Human immunodeficiency virus 1 infection
    109698042 (Hras)
   05161 Hepatitis B
    109698042 (Hras)
   05160 Hepatitis C
    109698042 (Hras)
   05163 Human cytomegalovirus infection
    109698042 (Hras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109698042 (Hras)
   05165 Human papillomavirus infection
    109698042 (Hras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109698042 (Hras)
   05022 Pathways of neurodegeneration - multiple diseases
    109698042 (Hras)
  09165 Substance dependence
   05034 Alcoholism
    109698042 (Hras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    109698042 (Hras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109698042 (Hras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109698042 (Hras)
   01522 Endocrine resistance
    109698042 (Hras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccan04131]
    109698042 (Hras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccan04147]
    109698042 (Hras)
   04031 GTP-binding proteins [BR:ccan04031]
    109698042 (Hras)
Membrane trafficking [BR:ccan04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    109698042 (Hras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109698042 (Hras)
Exosome [BR:ccan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109698042 (Hras)
  Exosomal proteins of colorectal cancer cells
   109698042 (Hras)
GTP-binding proteins [BR:ccan04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109698042 (Hras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 109698042
NCBI-ProteinID: XP_020037583
UniProt: A0A8C0WGH3
LinkDB
Position
Unknown
AA seq 193 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYSIPYIETSAKTRQGSRSGSGSSSGTLWDPPGTHVTQRPPRWCG
GRLLHTGAGNSAA
NT seq 582 nt   +upstreamnt  +downstreamnt
atgacggagtataaacttgtggtggtgggcgctggaggcgtggggaaaagtgccctaact
atccagctgatccagaaccactttgtggatgagtatgaccccaccatagaggactcatac
cggaagcaggtggtcattgatggggagacatgcctgctggacatcttggacacagcaggc
caggaggagtacagtgccatgcgggaccagtatatgcgcactggggaaggcttcctctgt
gtgtttgccatcaacaacaccaagtccttcgaagacatccatcagtacagggagcagatc
aagagggtgaaggactcggacgatgtgccaatggtgctggttgggaacaagtgtgacctg
gctgcgcgcaccgtagagtctcggcaggcccaggaccttgcccgaagctacagcatccct
tatatcgagacttcagccaagacccggcagggcagccgctctggctctggctccagctcc
gggaccctctgggaccctcccgggacccatgtgacccagcggcccccacgctggtgtgga
ggacgccttctacacactggtgcgggaaattcggcagcataa

DBGET integrated database retrieval system