Castor canadensis (American beaver): 109698042 Help Entry 109698042         CDS       T04791                                  Symbol Hras Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism ccan  Castor canadensis (American beaver) Pathway ccan01521   EGFR tyrosine kinase inhibitor resistance ccan01522   Endocrine resistance ccan04010   MAPK signaling pathway ccan04012   ErbB signaling pathway ccan04014   Ras signaling pathway ccan04015   Rap1 signaling pathway ccan04062   Chemokine signaling pathway ccan04068   FoxO signaling pathway ccan04071   Sphingolipid signaling pathway ccan04072   Phospholipase D signaling pathway ccan04137   Mitophagy - animal ccan04140   Autophagy - animal ccan04144   Endocytosis ccan04150   mTOR signaling pathway ccan04151   PI3K-Akt signaling pathway ccan04210   Apoptosis ccan04211   Longevity regulating pathway ccan04213   Longevity regulating pathway - multiple species ccan04218   Cellular senescence ccan04360   Axon guidance ccan04370   VEGF signaling pathway ccan04371   Apelin signaling pathway ccan04510   Focal adhesion ccan04540   Gap junction ccan04550   Signaling pathways regulating pluripotency of stem cells ccan04625   C-type lectin receptor signaling pathway ccan04630   JAK-STAT signaling pathway ccan04650   Natural killer cell mediated cytotoxicity ccan04660   T cell receptor signaling pathway ccan04662   B cell receptor signaling pathway ccan04664   Fc epsilon RI signaling pathway ccan04714   Thermogenesis ccan04720   Long-term potentiation ccan04722   Neurotrophin signaling pathway ccan04725   Cholinergic synapse ccan04726   Serotonergic synapse ccan04730   Long-term depression ccan04810   Regulation of actin cytoskeleton ccan04910   Insulin signaling pathway ccan04912   GnRH signaling pathway ccan04915   Estrogen signaling pathway ccan04916   Melanogenesis ccan04917   Prolactin signaling pathway ccan04919   Thyroid hormone signaling pathway ccan04921   Oxytocin signaling pathway ccan04926   Relaxin signaling pathway ccan04929   GnRH secretion ccan04933   AGE-RAGE signaling pathway in diabetic complications ccan04935   Growth hormone synthesis, secretion and action ccan05010   Alzheimer disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05034   Alcoholism ccan05132   Salmonella infection ccan05160   Hepatitis C ccan05161   Hepatitis B ccan05163   Human cytomegalovirus infection ccan05165   Human papillomavirus infection ccan05166   Human T-cell leukemia virus 1 infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05170   Human immunodeficiency virus 1 infection ccan05200   Pathways in cancer ccan05203   Viral carcinogenesis ccan05205   Proteoglycans in cancer ccan05206   MicroRNAs in cancer ccan05207   Chemical carcinogenesis - receptor activation ccan05208   Chemical carcinogenesis - reactive oxygen species ccan05210   Colorectal cancer ccan05211   Renal cell carcinoma ccan05213   Endometrial cancer ccan05214   Glioma ccan05215   Prostate cancer ccan05216   Thyroid cancer ccan05218   Melanoma ccan05219   Bladder cancer ccan05220   Chronic myeloid leukemia ccan05221   Acute myeloid leukemia ccan05223   Non-small cell lung cancer ccan05224   Breast cancer ccan05225   Hepatocellular carcinoma ccan05226   Gastric cancer ccan05230   Central carbon metabolism in cancer ccan05231   Choline metabolism in cancer ccan05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109698042 (Hras)    04015 Rap1 signaling pathway     109698042 (Hras)    04630 JAK-STAT signaling pathway     109698042 (Hras)    04068 FoxO signaling pathway     109698042 (Hras)    04072 Phospholipase D signaling pathway     109698042 (Hras)    04071 Sphingolipid signaling pathway     109698042 (Hras)    04151 PI3K-Akt signaling pathway     109698042 (Hras)    04150 mTOR signaling pathway     109698042 (Hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109698042 (Hras)    04140 Autophagy - animal     109698042 (Hras)    04137 Mitophagy - animal     109698042 (Hras)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     109698042 (Hras)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     109698042 (Hras)    04660 T cell receptor signaling pathway     109698042 (Hras)    04662 B cell receptor signaling pathway     109698042 (Hras)    04664 Fc epsilon RI signaling pathway     109698042 (Hras)    04062 Chemokine signaling pathway     109698042 (Hras)   09152 Endocrine system    04929 GnRH secretion     109698042 (Hras)    04915 Estrogen signaling pathway     109698042 (Hras)    04917 Prolactin signaling pathway     109698042 (Hras)    04921 Oxytocin signaling pathway     109698042 (Hras)    04926 Relaxin signaling pathway     109698042 (Hras)    04935 Growth hormone synthesis, secretion and action     109698042 (Hras)    04919 Thyroid hormone signaling pathway     109698042 (Hras)   09156 Nervous system    04725 Cholinergic synapse     109698042 (Hras)    04726 Serotonergic synapse     109698042 (Hras)    04720 Long-term potentiation     109698042 (Hras)    04730 Long-term depression     109698042 (Hras)    04722 Neurotrophin signaling pathway     109698042 (Hras)   09158 Development and regeneration    04360 Axon guidance     109698042 (Hras)   09149 Aging    04211 Longevity regulating pathway     109698042 (Hras)    04213 Longevity regulating pathway - multiple species     109698042 (Hras)   09159 Environmental adaptation    04714 Thermogenesis     109698042 (Hras)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109698042 (Hras)    05206 MicroRNAs in cancer     109698042 (Hras)    05205 Proteoglycans in cancer     109698042 (Hras)    05207 Chemical carcinogenesis - receptor activation     109698042 (Hras)    05208 Chemical carcinogenesis - reactive oxygen species     109698042 (Hras)    05203 Viral carcinogenesis     109698042 (Hras)    05230 Central carbon metabolism in cancer     109698042 (Hras)    05231 Choline metabolism in cancer     109698042 (Hras)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109698042 (Hras)   09162 Cancer: specific types    05210 Colorectal cancer     109698042 (Hras)    05225 Hepatocellular carcinoma     109698042 (Hras)    05226 Gastric cancer     109698042 (Hras)    05214 Glioma     109698042 (Hras)    05216 Thyroid cancer     109698042 (Hras)    05221 Acute myeloid leukemia     109698042 (Hras)    05220 Chronic myeloid leukemia     109698042 (Hras)    05218 Melanoma     109698042 (Hras)    05211 Renal cell carcinoma     109698042 (Hras)    05219 Bladder cancer     109698042 (Hras)    05215 Prostate cancer     109698042 (Hras)    05213 Endometrial cancer     109698042 (Hras)    05224 Breast cancer     109698042 (Hras)    05223 Non-small cell lung cancer     109698042 (Hras)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109698042 (Hras)    05170 Human immunodeficiency virus 1 infection     109698042 (Hras)    05161 Hepatitis B     109698042 (Hras)    05160 Hepatitis C     109698042 (Hras)    05163 Human cytomegalovirus infection     109698042 (Hras)    05167 Kaposi sarcoma-associated herpesvirus infection     109698042 (Hras)    05165 Human papillomavirus infection     109698042 (Hras)   09164 Neurodegenerative disease    05010 Alzheimer disease     109698042 (Hras)    05022 Pathways of neurodegeneration - multiple diseases     109698042 (Hras)   09165 Substance dependence    05034 Alcoholism     109698042 (Hras)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109698042 (Hras)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     109698042 (Hras)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109698042 (Hras)    01522 Endocrine resistance     109698042 (Hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccan04131]     109698042 (Hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109698042 (Hras)    04031 GTP-binding proteins [BR:ccan04031]     109698042 (Hras) Membrane trafficking [BR:ccan04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     109698042 (Hras)  Endocytosis   Macropinocytosis    Ras GTPases     109698042 (Hras) Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109698042 (Hras)   Exosomal proteins of colorectal cancer cells    109698042 (Hras) GTP-binding proteins [BR:ccan04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109698042 (Hras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  109698042 NCBI-ProteinID:  XP_020037583 UniProt:  A0A8C0WGH3 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYSIPYIETSAKTRQGSRSGSGSSSGTLWDPPGTHVTQRPPRWCG GRLLHTGAGNSAA NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataaacttgtggtggtgggcgctggaggcgtggggaaaagtgccctaact atccagctgatccagaaccactttgtggatgagtatgaccccaccatagaggactcatac cggaagcaggtggtcattgatggggagacatgcctgctggacatcttggacacagcaggc caggaggagtacagtgccatgcgggaccagtatatgcgcactggggaaggcttcctctgt gtgtttgccatcaacaacaccaagtccttcgaagacatccatcagtacagggagcagatc aagagggtgaaggactcggacgatgtgccaatggtgctggttgggaacaagtgtgacctg gctgcgcgcaccgtagagtctcggcaggcccaggaccttgcccgaagctacagcatccct tatatcgagacttcagccaagacccggcagggcagccgctctggctctggctccagctcc gggaccctctgggaccctcccgggacccatgtgacccagcggcccccacgctggtgtgga ggacgccttctacacactggtgcgggaaattcggcagcataa

DBGET integrated database retrieval system