Castor canadensis (American beaver): 109699301 Help Entry 109699301         CDS       T04791                                  Name (RefSeq) actin-related protein 3-like   KO K18584   actin-related protein 3 Organism ccan  Castor canadensis (American beaver) Pathway ccan04144   Endocytosis ccan04530   Tight junction ccan04666   Fc gamma R-mediated phagocytosis ccan04810   Regulation of actin cytoskeleton ccan05100   Bacterial invasion of epithelial cells ccan05132   Salmonella infection ccan05135   Yersinia infection Brite KEGG Orthology (KO) [BR:ccan00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109699301   09144 Cellular community - eukaryotes    04530 Tight junction     109699301   09142 Cell motility    04810 Regulation of actin cytoskeleton     109699301  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     109699301  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109699301    05135 Yersinia infection     109699301    05100 Bacterial invasion of epithelial cells     109699301  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccan04131]     109699301   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccan04812]     109699301    04147 Exosome [BR:ccan04147]     109699301 Membrane trafficking [BR:ccan04131]  Others   Actin-binding proteins    Arp2/3 complex     109699301 Cytoskeleton proteins [BR:ccan04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Arp2/3 complex      109699301 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109699301   Exosomal proteins of other body fluids (saliva and urine)    109699301   Exosomal proteins of bladder cancer cells    109699301 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin TEN_TERT Motif Other DBs NCBI-GeneID:  109699301 NCBI-ProteinID:  XP_020039535 UniProt:  A0A8B7WBV5 LinkDB All DBs Position Unknown AA seq 178 aa AA seqDB search MWSTTGVKEDLEYHRVAHHLVQSGALPYSSAAQPPAGGTRGRDITYFIQQLLRDREVGIP PEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERF LGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKVSTQQQKLLFTYKKYEI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgtggagcaccactggggtgaaggaggacctggaataccatcgggtggcgcaccatcta gttcagtccggtgcccttccctactccagtgcagcccagccaccagctggtggcacaagg ggacgagatataacatattttattcagcaactgctgagagaccgagaagtaggaatccct ccagaacaatccctggaaactgctaaggcagtaaaggagcgctatagttacgtctgccca gatttagtaaaagaatttaacaagtatgacactgatgggtcaaagtggattaagcaatat actggaatcaatgctatctcaaagaaagagttttccattgatgttggttatgagagattt ttgggacctgaaatcttttttcatccagagtttgctaatccagactttacacaacctatc tcagaagttgtagatgaagtaattcagaactgtcctattgatgtcagacgtcctctctac aaggtcagtacacaacagcaaaaattgttattcacgtataaaaagtatgaaatataa

DBGET integrated database retrieval system