Castor canadensis (American beaver): 109700220 Help Entry 109700220         CDS       T04791                                  Symbol Ccl28 Name (RefSeq) C-C motif chemokine 28   KO K05513   C-C motif chemokine 28 Organism ccan  Castor canadensis (American beaver) Pathway ccan04060   Cytokine-cytokine receptor interaction ccan04061   Viral protein interaction with cytokine and cytokine receptor ccan04062   Chemokine signaling pathway ccan04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109700220 (Ccl28)    04061 Viral protein interaction with cytokine and cytokine receptor     109700220 (Ccl28)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     109700220 (Ccl28)    04062 Chemokine signaling pathway     109700220 (Ccl28)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109700220 (Ccl28) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Chemokines    109700220 (Ccl28) SSDB OrthologParalogGFIT Motif Pfam:  IL8 MBF1 UL128 Motif Other DBs NCBI-GeneID:  109700220 NCBI-ProteinID:  XP_020040877 UniProt:  A0A8B7WA29 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MRQTGLVFMAMAVCVALPTSEAILPIASSCCTEVSHHISRRLLERVNVCRIQRADGDCDL AAVILHVRRRKICVSPHNHTIKQWMKAQAAKKNGEDICLKKKHHGKNRKGAHQEKI NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgcggcagacaggacttgtgttcatggccatggctgtctgtgtggctcttccaacctcg gaagccatacttcccattgcttccagctgttgcactgaagtttcacatcatatttccaga aggcttctggaaagagtgaatgtatgtcgtatccagagagctgatggggattgtgacttg gctgctgtcatacttcatgtcaggcgcagaaaaatctgtgtcagcccacacaatcatacc attaagcagtggatgaaagcacaagcagccaagaaaaatggtgaagacatttgccttaag aagaaacaccatggcaagaacagaaaaggggcccatcaggagaaaatatga

DBGET integrated database retrieval system