Castor canadensis (American beaver): 109700244 Help Entry 109700244         CDS       T04791                                  Symbol Arf1 Name (RefSeq) ADP-ribosylation factor 1   KO K07937   ADP-ribosylation factor 1/2 Organism ccan  Castor canadensis (American beaver) Pathway ccan04072   Phospholipase D signaling pathway ccan04144   Endocytosis ccan05132   Salmonella infection ccan05134   Legionellosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     109700244 (Arf1)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109700244 (Arf1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109700244 (Arf1)    05134 Legionellosis     109700244 (Arf1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccan04131]     109700244 (Arf1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109700244 (Arf1)    04031 GTP-binding proteins [BR:ccan04031]     109700244 (Arf1) Membrane trafficking [BR:ccan04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     109700244 (Arf1)   Arf GTPases and associated proteins    Arf GTPases     109700244 (Arf1)  Endosome - Golgi transport     109700244 (Arf1) Exosome [BR:ccan04147]  Exosomal proteins   Proteins found in most exosomes    109700244 (Arf1) GTP-binding proteins [BR:ccan04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     109700244 (Arf1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K FLAD1_M cobW Motif Other DBs NCBI-GeneID:  109700244 NCBI-ProteinID:  XP_020040912 UniProt:  A0A250YB79 LinkDB All DBs Position Unknown AA seq 181 aa AA seqDB search MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ K NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggggaatatctttgcaaacctcttcaagggcctttttggcaaaaaagaaatgcgcatc ctcatggtgggtcttgatgccgcaggaaagacaacaattctgtacaaactgaagctgggt gaaatcgtgaccactattcccaccataggtttcaacgtggagactgttgagtacaagaac atcagcttcactgtgtgggacgtgggtggccaagacaagatccgaccgctgtggcgccac tacttccagaacacccaaggcttgatcttcgtggtggacagcaatgacagagagcgtgtg aatgaggcccgtgaggagctcatgcggatgctggctgaggatgagctccgggatgctgtc ctcctggtgtttgccaacaagcaggaccttcccaatgccatgaacgctgctgaaatcaca gacaagctggggctgcactctctacgccacaggaactggtacattcaggccacctgtgcc accagtggggacgggctctatgaaggactggactggctgtccaatcagctccggaaccag aagtga

DBGET integrated database retrieval system