Castor canadensis (American beaver): 109700777 Help Entry 109700777         CDS       T04791                                  Symbol Jun Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism ccan  Castor canadensis (American beaver) Pathway ccan01522   Endocrine resistance ccan04010   MAPK signaling pathway ccan04012   ErbB signaling pathway ccan04024   cAMP signaling pathway ccan04137   Mitophagy - animal ccan04210   Apoptosis ccan04310   Wnt signaling pathway ccan04380   Osteoclast differentiation ccan04510   Focal adhesion ccan04530   Tight junction ccan04620   Toll-like receptor signaling pathway ccan04621   NOD-like receptor signaling pathway ccan04625   C-type lectin receptor signaling pathway ccan04657   IL-17 signaling pathway ccan04658   Th1 and Th2 cell differentiation ccan04659   Th17 cell differentiation ccan04660   T cell receptor signaling pathway ccan04662   B cell receptor signaling pathway ccan04668   TNF signaling pathway ccan04722   Neurotrophin signaling pathway ccan04912   GnRH signaling pathway ccan04915   Estrogen signaling pathway ccan04921   Oxytocin signaling pathway ccan04926   Relaxin signaling pathway ccan04932   Non-alcoholic fatty liver disease ccan04933   AGE-RAGE signaling pathway in diabetic complications ccan05030   Cocaine addiction ccan05031   Amphetamine addiction ccan05132   Salmonella infection ccan05133   Pertussis ccan05135   Yersinia infection ccan05140   Leishmaniasis ccan05142   Chagas disease ccan05161   Hepatitis B ccan05162   Measles ccan05166   Human T-cell leukemia virus 1 infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05169   Epstein-Barr virus infection ccan05170   Human immunodeficiency virus 1 infection ccan05171   Coronavirus disease - COVID-19 ccan05200   Pathways in cancer ccan05203   Viral carcinogenesis ccan05207   Chemical carcinogenesis - receptor activation ccan05208   Chemical carcinogenesis - reactive oxygen species ccan05210   Colorectal cancer ccan05211   Renal cell carcinoma ccan05224   Breast cancer ccan05231   Choline metabolism in cancer ccan05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccan05321   Inflammatory bowel disease ccan05323   Rheumatoid arthritis ccan05417   Lipid and atherosclerosis ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109700777 (Jun)    04012 ErbB signaling pathway     109700777 (Jun)    04310 Wnt signaling pathway     109700777 (Jun)    04668 TNF signaling pathway     109700777 (Jun)    04024 cAMP signaling pathway     109700777 (Jun)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     109700777 (Jun)   09143 Cell growth and death    04210 Apoptosis     109700777 (Jun)   09144 Cellular community - eukaryotes    04510 Focal adhesion     109700777 (Jun)    04530 Tight junction     109700777 (Jun)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109700777 (Jun)    04621 NOD-like receptor signaling pathway     109700777 (Jun)    04625 C-type lectin receptor signaling pathway     109700777 (Jun)    04660 T cell receptor signaling pathway     109700777 (Jun)    04658 Th1 and Th2 cell differentiation     109700777 (Jun)    04659 Th17 cell differentiation     109700777 (Jun)    04657 IL-17 signaling pathway     109700777 (Jun)    04662 B cell receptor signaling pathway     109700777 (Jun)   09152 Endocrine system    04912 GnRH signaling pathway     109700777 (Jun)    04915 Estrogen signaling pathway     109700777 (Jun)    04921 Oxytocin signaling pathway     109700777 (Jun)    04926 Relaxin signaling pathway     109700777 (Jun)   09156 Nervous system    04722 Neurotrophin signaling pathway     109700777 (Jun)   09158 Development and regeneration    04380 Osteoclast differentiation     109700777 (Jun)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109700777 (Jun)    05207 Chemical carcinogenesis - receptor activation     109700777 (Jun)    05208 Chemical carcinogenesis - reactive oxygen species     109700777 (Jun)    05203 Viral carcinogenesis     109700777 (Jun)    05231 Choline metabolism in cancer     109700777 (Jun)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109700777 (Jun)   09162 Cancer: specific types    05210 Colorectal cancer     109700777 (Jun)    05211 Renal cell carcinoma     109700777 (Jun)    05224 Breast cancer     109700777 (Jun)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109700777 (Jun)    05170 Human immunodeficiency virus 1 infection     109700777 (Jun)    05161 Hepatitis B     109700777 (Jun)    05171 Coronavirus disease - COVID-19     109700777 (Jun)    05162 Measles     109700777 (Jun)    05167 Kaposi sarcoma-associated herpesvirus infection     109700777 (Jun)    05169 Epstein-Barr virus infection     109700777 (Jun)   09171 Infectious disease: bacterial    05132 Salmonella infection     109700777 (Jun)    05135 Yersinia infection     109700777 (Jun)    05133 Pertussis     109700777 (Jun)   09174 Infectious disease: parasitic    05140 Leishmaniasis     109700777 (Jun)    05142 Chagas disease     109700777 (Jun)   09163 Immune disease    05323 Rheumatoid arthritis     109700777 (Jun)    05321 Inflammatory bowel disease     109700777 (Jun)   09165 Substance dependence    05030 Cocaine addiction     109700777 (Jun)    05031 Amphetamine addiction     109700777 (Jun)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109700777 (Jun)    05418 Fluid shear stress and atherosclerosis     109700777 (Jun)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     109700777 (Jun)    04933 AGE-RAGE signaling pathway in diabetic complications     109700777 (Jun)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     109700777 (Jun)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ccan03000]     109700777 (Jun) Transcription factors [BR:ccan03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     109700777 (Jun) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch Motif Other DBs NCBI-GeneID:  109700777 NCBI-ProteinID:  XP_020041676 UniProt:  A0A250XYQ2 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSTAQPVSGAGMVAPAVASVAGGSGNGGFSAGLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQPQQPPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggcggacccggtaggcagcctgaagccgcacctccgcgccaagaactcggacctc ctcacctcgcccgacgtgggtctgctcaagctggcatcacccgagctggagcgtcttatt attcagtccagcaacgggcacatcaccactacgccgacccccacccagttcctgtgcccc aagaacgtgaccgatgagcaggagggctttgccgagggcttcgtgcgcgcgctggctgaa ctgcacagccaaaacacgctacccagcgtcacatccacggcccagccggtcagcggggcg ggaatggtggctcccgcggtggcctcggtggcgggcggcagcggcaacggcggcttcagc gccggcctgcacagcgaaccgccggtctacgccaacctcagcaacttcaaccccggcgcc ctgagcagtggcggcggggcgccttcctacggcgcggccggcctggcctttcccgcgcag ccccagccgcaacagccgccaccgcagccaccgcaccacctgccccagcagatccctgtg cagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcctggc gaaaccccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagagg aagcgcatgaggaaccgcatcgccgcctccaaatgccggaaaaggaagctggagaggatc gcccggctggaggaaaaagtgaaaaccttgaaagcgcaaaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccatgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system