Castor canadensis (American beaver): 109700822 Help Entry 109700822         CDS       T04791                                  Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism ccan  Castor canadensis (American beaver) Pathway ccan03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     109700822  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccan03036]     109700822    03400 DNA repair and recombination proteins [BR:ccan03400]     109700822 Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      109700822 DNA repair and recombination proteins [BR:ccan03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      109700822 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa Bromo_TP DUF4087 Motif Other DBs NCBI-GeneID:  109700822 NCBI-ProteinID:  XP_020041740 UniProt:  A0A250YA14 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MEEEADAEEQQRFSYQQRLKAAVHYTVGCLCKEVALDKEMSFSKQTVAAISEVTFRQCEN FAKDLEMFARHAKRSTINTEDVKLLARRSNSLLKYITEKNEEIAQFNLERKAKKKKKLED GNKDSRESAEADVVESEG NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atggaggaggaagcggacgccgaggagcagcagcgattctcttaccagcagaggctgaag gcagcagtccactacacagttggctgtctttgcaaggaggttgcattggacaaagagatg tcgttcagcaagcaaactgttgcagcaatttcggaagtgacttttcgacagtgcgaaaat tttgccaaagaccttgaaatgtttgccagacatgcaaaaagaagcacaattaacactgaa gatgtgaagcttttagccaggaggagtaattcactgctaaaatacatcacagagaaaaat gaagaaattgctcagtttaacctagaaagaaaggcaaagaagaaaaagaagttggaggat ggaaacaaagattcccgggagtcggctgaggctgacgtggtggagagtgagggttaa

DBGET integrated database retrieval system