Castor canadensis (American beaver): 109700840 Help Entry 109700840         CDS       T04791                                  Symbol Calml5 Name (RefSeq) calmodulin-like protein 5   KO K02183   calmodulin Organism ccan  Castor canadensis (American beaver) Pathway ccan04014   Ras signaling pathway ccan04015   Rap1 signaling pathway ccan04020   Calcium signaling pathway ccan04022   cGMP-PKG signaling pathway ccan04024   cAMP signaling pathway ccan04070   Phosphatidylinositol signaling system ccan04114   Oocyte meiosis ccan04218   Cellular senescence ccan04261   Adrenergic signaling in cardiomyocytes ccan04270   Vascular smooth muscle contraction ccan04371   Apelin signaling pathway ccan04625   C-type lectin receptor signaling pathway ccan04713   Circadian entrainment ccan04720   Long-term potentiation ccan04722   Neurotrophin signaling pathway ccan04728   Dopaminergic synapse ccan04740   Olfactory transduction ccan04744   Phototransduction ccan04750   Inflammatory mediator regulation of TRP channels ccan04910   Insulin signaling pathway ccan04912   GnRH signaling pathway ccan04915   Estrogen signaling pathway ccan04916   Melanogenesis ccan04921   Oxytocin signaling pathway ccan04922   Glucagon signaling pathway ccan04924   Renin secretion ccan04925   Aldosterone synthesis and secretion ccan04970   Salivary secretion ccan04971   Gastric acid secretion ccan05010   Alzheimer disease ccan05012   Parkinson disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05031   Amphetamine addiction ccan05034   Alcoholism ccan05133   Pertussis ccan05152   Tuberculosis ccan05163   Human cytomegalovirus infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05170   Human immunodeficiency virus 1 infection ccan05200   Pathways in cancer ccan05214   Glioma ccan05417   Lipid and atherosclerosis ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109700840 (Calml5)    04015 Rap1 signaling pathway     109700840 (Calml5)    04371 Apelin signaling pathway     109700840 (Calml5)    04020 Calcium signaling pathway     109700840 (Calml5)    04070 Phosphatidylinositol signaling system     109700840 (Calml5)    04024 cAMP signaling pathway     109700840 (Calml5)    04022 cGMP-PKG signaling pathway     109700840 (Calml5)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     109700840 (Calml5)    04218 Cellular senescence     109700840 (Calml5)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109700840 (Calml5)   09152 Endocrine system    04910 Insulin signaling pathway     109700840 (Calml5)    04922 Glucagon signaling pathway     109700840 (Calml5)    04912 GnRH signaling pathway     109700840 (Calml5)    04915 Estrogen signaling pathway     109700840 (Calml5)    04921 Oxytocin signaling pathway     109700840 (Calml5)    04916 Melanogenesis     109700840 (Calml5)    04924 Renin secretion     109700840 (Calml5)    04925 Aldosterone synthesis and secretion     109700840 (Calml5)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     109700840 (Calml5)    04270 Vascular smooth muscle contraction     109700840 (Calml5)   09154 Digestive system    04970 Salivary secretion     109700840 (Calml5)    04971 Gastric acid secretion     109700840 (Calml5)   09156 Nervous system    04728 Dopaminergic synapse     109700840 (Calml5)    04720 Long-term potentiation     109700840 (Calml5)    04722 Neurotrophin signaling pathway     109700840 (Calml5)   09157 Sensory system    04744 Phototransduction     109700840 (Calml5)    04740 Olfactory transduction     109700840 (Calml5)    04750 Inflammatory mediator regulation of TRP channels     109700840 (Calml5)   09159 Environmental adaptation    04713 Circadian entrainment     109700840 (Calml5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109700840 (Calml5)   09162 Cancer: specific types    05214 Glioma     109700840 (Calml5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109700840 (Calml5)    05163 Human cytomegalovirus infection     109700840 (Calml5)    05167 Kaposi sarcoma-associated herpesvirus infection     109700840 (Calml5)   09171 Infectious disease: bacterial    05133 Pertussis     109700840 (Calml5)    05152 Tuberculosis     109700840 (Calml5)   09164 Neurodegenerative disease    05010 Alzheimer disease     109700840 (Calml5)    05012 Parkinson disease     109700840 (Calml5)    05022 Pathways of neurodegeneration - multiple diseases     109700840 (Calml5)   09165 Substance dependence    05031 Amphetamine addiction     109700840 (Calml5)    05034 Alcoholism     109700840 (Calml5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109700840 (Calml5)    05418 Fluid shear stress and atherosclerosis     109700840 (Calml5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccan01009]     109700840 (Calml5)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccan04131]     109700840 (Calml5)    03036 Chromosome and associated proteins [BR:ccan03036]     109700840 (Calml5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109700840 (Calml5) Protein phosphatases and associated proteins [BR:ccan01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109700840 (Calml5) Membrane trafficking [BR:ccan04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109700840 (Calml5) Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109700840 (Calml5) Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109700840 (Calml5) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 EF-hand_FSTL1 EH Allatotropin-like_C SPARC_Ca_bdg Dockerin_1 CFAP251_C EF-hand_STIM1 UPF0154 EF-hand_EFHB_C Temptin_C EF_EFCAB10_C DUF5580_M TerB ExbD DUF3349 EF-hand_11 FCaBP_EF-hand MTIP_N GhoS T2SSK Motif Other DBs NCBI-GeneID:  109700840 NCBI-ProteinID:  XP_020041766 UniProt:  A0A8B7WC66 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MAEELSPEQVEQYRAAFSRCDTDEDGKINVQELGEVMKALGQNLSEADLKKIIASVDTDG DGTISFQEFLAVVAKKMKNGPTEEELRMVFRAFDLNGDGHISVEELKQAMVQVGEQLSQE ELDTMIREADVDKDGKVNYEEFVRILTQK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagaagaactgtctccagagcaggtggaacagtaccgtgcagccttctccaggtgc gacacagatgaggacggcaaaattaatgtccaggagctgggcgaggtgatgaaggccctg ggtcagaacctctcagaggccgatttgaagaagatcattgccagcgtagacacagatggt gatggcactatcagcttccaagagttcctggcagtggtggccaagaagatgaagaatggg cccactgaagaggaacttcggatggtcttccgtgcctttgacctgaatggtgatggtcac atcagtgtggaggagctcaagcaggccatggtccaggttggggagcagctttcccaggag gagctggacaccatgatccgcgaggcagatgtggacaaggacgggaaggtgaactatgag gagtttgtgcgcatcctcacccagaagtga

DBGET integrated database retrieval system