Castor canadensis (American beaver): 109700986 Help Entry 109700986         CDS       T04791                                  Symbol Sst Name (RefSeq) somatostatin   KO K05237   somatostatin Organism ccan  Castor canadensis (American beaver) Pathway ccan04024   cAMP signaling pathway ccan04080   Neuroactive ligand-receptor interaction ccan04081   Hormone signaling ccan04935   Growth hormone synthesis, secretion and action ccan04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     109700986 (Sst)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     109700986 (Sst)    04081 Hormone signaling     109700986 (Sst)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     109700986 (Sst)   09154 Digestive system    04971 Gastric acid secretion     109700986 (Sst)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109700986 (Sst) Cytokines and neuropeptides [BR:ccan04052]  Neuropeptides   GPCR binding    109700986 (Sst) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  109700986 NCBI-ProteinID:  XP_020041936 UniProt:  A0A8C0WAA5 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALSIILALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctccatcatcctagccctgggc ggtgtcaccggcgcgccctcggaccccagactccgtcagtttctgcagaagtccctggct gctgccgcaggaaagcaggaactggccaagtacttcttggcagagctgctgtctgagccc aaccagacggagaatgatgccctggaacctgaagatttgtcccaggctgcagaacaggat gagatgaggctggagctgcagagatctgctaactcaaacccagccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagacgttcacatcctgttag

DBGET integrated database retrieval system