Castor canadensis (American beaver): 109701168 Help Entry 109701168         CDS       T04791                                  Symbol Il1b Name (RefSeq) interleukin-1 beta isoform X1   KO K04519   interleukin 1 beta Organism ccan  Castor canadensis (American beaver) Pathway ccan01523   Antifolate resistance ccan04010   MAPK signaling pathway ccan04060   Cytokine-cytokine receptor interaction ccan04064   NF-kappa B signaling pathway ccan04217   Necroptosis ccan04380   Osteoclast differentiation ccan04620   Toll-like receptor signaling pathway ccan04621   NOD-like receptor signaling pathway ccan04623   Cytosolic DNA-sensing pathway ccan04625   C-type lectin receptor signaling pathway ccan04640   Hematopoietic cell lineage ccan04657   IL-17 signaling pathway ccan04659   Th17 cell differentiation ccan04668   TNF signaling pathway ccan04750   Inflammatory mediator regulation of TRP channels ccan04932   Non-alcoholic fatty liver disease ccan04933   AGE-RAGE signaling pathway in diabetic complications ccan04936   Alcoholic liver disease ccan04940   Type I diabetes mellitus ccan05010   Alzheimer disease ccan05020   Prion disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05132   Salmonella infection ccan05133   Pertussis ccan05134   Legionellosis ccan05135   Yersinia infection ccan05140   Leishmaniasis ccan05142   Chagas disease ccan05143   African trypanosomiasis ccan05144   Malaria ccan05146   Amoebiasis ccan05152   Tuberculosis ccan05162   Measles ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05168   Herpes simplex virus 1 infection ccan05171   Coronavirus disease - COVID-19 ccan05321   Inflammatory bowel disease ccan05323   Rheumatoid arthritis ccan05332   Graft-versus-host disease ccan05417   Lipid and atherosclerosis ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109701168 (Il1b)    04064 NF-kappa B signaling pathway     109701168 (Il1b)    04668 TNF signaling pathway     109701168 (Il1b)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109701168 (Il1b)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109701168 (Il1b)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109701168 (Il1b)    04620 Toll-like receptor signaling pathway     109701168 (Il1b)    04621 NOD-like receptor signaling pathway     109701168 (Il1b)    04623 Cytosolic DNA-sensing pathway     109701168 (Il1b)    04625 C-type lectin receptor signaling pathway     109701168 (Il1b)    04659 Th17 cell differentiation     109701168 (Il1b)    04657 IL-17 signaling pathway     109701168 (Il1b)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     109701168 (Il1b)   09158 Development and regeneration    04380 Osteoclast differentiation     109701168 (Il1b)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     109701168 (Il1b)    05164 Influenza A     109701168 (Il1b)    05162 Measles     109701168 (Il1b)    05168 Herpes simplex virus 1 infection     109701168 (Il1b)    05163 Human cytomegalovirus infection     109701168 (Il1b)   09171 Infectious disease: bacterial    05132 Salmonella infection     109701168 (Il1b)    05135 Yersinia infection     109701168 (Il1b)    05133 Pertussis     109701168 (Il1b)    05134 Legionellosis     109701168 (Il1b)    05152 Tuberculosis     109701168 (Il1b)   09174 Infectious disease: parasitic    05146 Amoebiasis     109701168 (Il1b)    05144 Malaria     109701168 (Il1b)    05140 Leishmaniasis     109701168 (Il1b)    05142 Chagas disease     109701168 (Il1b)    05143 African trypanosomiasis     109701168 (Il1b)   09163 Immune disease    05323 Rheumatoid arthritis     109701168 (Il1b)    05321 Inflammatory bowel disease     109701168 (Il1b)    05332 Graft-versus-host disease     109701168 (Il1b)   09164 Neurodegenerative disease    05010 Alzheimer disease     109701168 (Il1b)    05020 Prion disease     109701168 (Il1b)    05022 Pathways of neurodegeneration - multiple diseases     109701168 (Il1b)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109701168 (Il1b)    05418 Fluid shear stress and atherosclerosis     109701168 (Il1b)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109701168 (Il1b)    04936 Alcoholic liver disease     109701168 (Il1b)    04932 Non-alcoholic fatty liver disease     109701168 (Il1b)    04933 AGE-RAGE signaling pathway in diabetic complications     109701168 (Il1b)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     109701168 (Il1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109701168 (Il1b)    00536 Glycosaminoglycan binding proteins [BR:ccan00536]     109701168 (Il1b) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Interleukins    109701168 (Il1b) Glycosaminoglycan binding proteins [BR:ccan00536]  Heparan sulfate / Heparin   Cytokines    109701168 (Il1b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  109701168 NCBI-ProteinID:  XP_020042185 UniProt:  A0A8B7WFK4 LinkDB All DBs Position Unknown AA seq 282 aa AA seqDB search MVTHFLLFSQLSEAAMAAVPELTSEIMAFHSDDNDLFFEVDGPKQMKCCFQDLDLCCPDE GIQLQFSHQHLNKSLKHVVSLIVAVEKLRKKPIACSQAFQNDDLKNFFSFIFEEEPIFYE TWDDDDYVCDASVRSLNCRLRDGQQKCLVLSDPYELKALHLNGQNLSQQVVFSMSFVQGE ESSGKIPVALGIKGKNLYLSCVMKDEKPTLLLESVDPKQYPKRKMEKRFVFNKIEIKNRV EFESAQFPNWYISTSQANQLPVFLGNSGGQDITDFTMEFVSS NT seq 849 nt NT seq  +upstreamnt  +downstreamnt atggtcactcactttctcctcttttcacagctctctgaagcagccatggcagcagttcct gaactcaccagtgaaataatggctttccacagtgatgataatgacctgttctttgaggtt gatggtcccaaacagatgaagtgctgcttccaagacctggacctctgctgtcctgatgaa ggcatccagctgcagttctcccaccagcacctcaacaagagcttgaagcatgtggtttct ctcatcgtggctgtggagaagctgaggaagaaacctattgcttgctcacaggccttccag aatgatgacctgaagaacttcttttccttcatctttgaagaagaacccatcttctatgaa acatgggatgatgacgattatgtgtgtgatgcatcagtacgatcactgaactgcaggctc cgggatggacagcaaaaatgtcttgtgttgtctgatccctatgagctgaaagctctccac ctcaatgggcagaatctgagccaacaagtggtgttctccatgagctttgtacaaggagaa gaaagtagcggcaaaatacctgtagccttgggcatcaaggggaagaatctgtacctgtcc tgtgtgatgaaagatgagaagcccaccctgctgctggagagtgtcgaccccaaacaatac ccaaagaggaagatggaaaagcgatttgtcttcaacaagatagaaatcaaaaacagggta gaatttgagtctgctcagttcccaaattggtacatcagtacctctcaagcaaaccaactg cctgtcttcttgggaaacagcggtggccaagatataactgacttcaccatggaatttgtg tcttcctaa

DBGET integrated database retrieval system