Castor canadensis (American beaver): 109701411 Help Entry 109701411         CDS       T04791                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism ccan  Castor canadensis (American beaver) Pathway ccan04382   Cornified envelope formation ccan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccan00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109701411  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109701411  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109701411 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of microglial cells    109701411 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  109701411 NCBI-ProteinID:  XP_020042530 UniProt:  A0A8B7WFY9 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETIMFTFHKYAGDKGYLIKEDLRILMDKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaaccataatgtttacatttcacaaatatgca ggagataaaggctacttaataaaggaggacctgaggatcctcatggataaggagttccct ggatttttggaaaatcaaaaagaccctctggctgtggacaaaataatgaaagacctggat cagtgccgagatggcaaagtgggcttccagagcttcttttcactaattgcaggcctcacc attgcatgcaatgactattttgtagtacatatgaaacagaagggaaagaagtaa

DBGET integrated database retrieval system