Castor canadensis (American beaver): 109702131 Help Entry 109702131         CDS       T04791                                  Symbol Prlh Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism ccan  Castor canadensis (American beaver) Pathway ccan04080   Neuroactive ligand-receptor interaction ccan04081   Hormone signaling Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     109702131 (Prlh)    04081 Hormone signaling     109702131 (Prlh)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109702131 (Prlh) Cytokines and neuropeptides [BR:ccan04052]  Neuropeptides   GPCR binding    109702131 (Prlh) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prolactin_RP Motif Other DBs NCBI-GeneID:  109702131 NCBI-ProteinID:  XP_020043152 UniProt:  A0A8B7WHR1 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MEPLRAWLLCLLLLGLVLPGVTNRARQHSMEVRTPDINPAWYTGRRIRPVGRFGRRRAAL QDVPKPGLWCRLTCLSLEGCAGSPQDE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggagcctctgagggcctggctcctgtgcctgctgttgctgggccttgtccttcccggt gtgacaaaccgagcccgccagcactccatggaggtccgcacccctgacatcaatcctgct tggtacacgggacgcaggatccgacctgtgggtcgcttcggccggaggagggcagctctg caggatgtcccaaaacctggcctgtggtgccggctgacctgcctttccctggagggctgt gctgggtccccacaggatgaatga

DBGET integrated database retrieval system