Castor canadensis (American beaver): 109702296 Help Entry 109702296         CDS       T04791                                  Symbol Il1a Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism ccan  Castor canadensis (American beaver) Pathway ccan04010   MAPK signaling pathway ccan04060   Cytokine-cytokine receptor interaction ccan04217   Necroptosis ccan04218   Cellular senescence ccan04380   Osteoclast differentiation ccan04640   Hematopoietic cell lineage ccan04932   Non-alcoholic fatty liver disease ccan04933   AGE-RAGE signaling pathway in diabetic complications ccan04940   Type I diabetes mellitus ccan05010   Alzheimer disease ccan05020   Prion disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05133   Pertussis ccan05140   Leishmaniasis ccan05152   Tuberculosis ccan05162   Measles ccan05164   Influenza A ccan05321   Inflammatory bowel disease ccan05323   Rheumatoid arthritis ccan05332   Graft-versus-host disease ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109702296 (Il1a)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109702296 (Il1a)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109702296 (Il1a)    04218 Cellular senescence     109702296 (Il1a)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109702296 (Il1a)   09158 Development and regeneration    04380 Osteoclast differentiation     109702296 (Il1a)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     109702296 (Il1a)    05162 Measles     109702296 (Il1a)   09171 Infectious disease: bacterial    05133 Pertussis     109702296 (Il1a)    05152 Tuberculosis     109702296 (Il1a)   09174 Infectious disease: parasitic    05140 Leishmaniasis     109702296 (Il1a)   09163 Immune disease    05323 Rheumatoid arthritis     109702296 (Il1a)    05321 Inflammatory bowel disease     109702296 (Il1a)    05332 Graft-versus-host disease     109702296 (Il1a)   09164 Neurodegenerative disease    05010 Alzheimer disease     109702296 (Il1a)    05020 Prion disease     109702296 (Il1a)    05022 Pathways of neurodegeneration - multiple diseases     109702296 (Il1a)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109702296 (Il1a)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109702296 (Il1a)    04932 Non-alcoholic fatty liver disease     109702296 (Il1a)    04933 AGE-RAGE signaling pathway in diabetic complications     109702296 (Il1a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109702296 (Il1a) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Interleukins    109702296 (Il1a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  109702296 NCBI-ProteinID:  XP_020043272 UniProt:  A0A8B7WI28 LinkDB All DBs Position Unknown AA seq 272 aa AA seqDB search MAEVPDLFADLKNCYSENEEYSSTIDQLSLNQKSFYDAAYGPLHENCMDKFVSVSTSETS KASKLNFKEGLVVVAKSTNGKILKKRWLSLNQTITDDDLEAITNDTEEEIIKPRSATHTF QSNMRYKYMKIIKQQFVLNDALNQSIIRDTSGQYLKAVPLNNQTINLEVKFDMGAYIPVT EASKLPVTLRISKTRLFVSVQKEDDPVLLKEMPETPKTITESESNLLFFWETHGTKNYFT SAAHPELFIATNEETLVHMAKGLPSITDFQIS NT seq 819 nt NT seq  +upstreamnt  +downstreamnt atggctgaagttcctgacctgtttgcagacctgaagaattgttacagtgagaatgaagaa tacagttccaccattgaccaactttctctaaatcagaaatccttctatgatgcagcctat ggcccacttcatgagaactgcatggataaatttgtgtctgtgagcacctctgaaacctct aaggcatccaagctcaacttcaaggaaggcttagtggtggtggcaaaatcaaccaatggg aagattctgaagaagagatggctgagtttaaatcagaccatcactgatgatgacctggaa gccattaccaatgatacggaagaagaaatcatcaagccccggtcagccactcataccttc cagagcaatatgagatacaaatacatgaagatcatcaaacagcaatttgtcctgaatgat gccctcaatcaaagtataattcgagacacatcaggtcaatatctcaaggctgtcccatta aacaatcaaacaattaaccttgaagtgaaatttgacatgggtgcctacataccagtcacg gaggcttctaaacttcctgtaactttaagaatctcaaaaactcgtttgtttgtgagtgtg caaaaagaagatgatccagtgctactaaaggagatgcctgagacaccaaaaaccatcaca gagagtgagagcaacctcctcttcttctgggaaactcatggcacgaagaactacttcaca tcagctgcccatccagagttgttcattgccacaaacgaagaaactttagtgcacatggca aaggggctaccgtctatcacagactttcagatatcgtaa

DBGET integrated database retrieval system