Castor canadensis (American beaver): 109702386 Help Entry 109702386         CDS       T04791                                  Symbol Cxcl10 Name (RefSeq) C-X-C motif chemokine 10   KO K12671   C-X-C motif chemokine 10 Organism ccan  Castor canadensis (American beaver) Pathway ccan04060   Cytokine-cytokine receptor interaction ccan04061   Viral protein interaction with cytokine and cytokine receptor ccan04062   Chemokine signaling pathway ccan04620   Toll-like receptor signaling pathway ccan04622   RIG-I-like receptor signaling pathway ccan04623   Cytosolic DNA-sensing pathway ccan04657   IL-17 signaling pathway ccan04668   TNF signaling pathway ccan05160   Hepatitis C ccan05164   Influenza A ccan05169   Epstein-Barr virus infection ccan05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     109702386 (Cxcl10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109702386 (Cxcl10)    04061 Viral protein interaction with cytokine and cytokine receptor     109702386 (Cxcl10)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109702386 (Cxcl10)    04622 RIG-I-like receptor signaling pathway     109702386 (Cxcl10)    04623 Cytosolic DNA-sensing pathway     109702386 (Cxcl10)    04657 IL-17 signaling pathway     109702386 (Cxcl10)    04062 Chemokine signaling pathway     109702386 (Cxcl10)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     109702386 (Cxcl10)    05171 Coronavirus disease - COVID-19     109702386 (Cxcl10)    05164 Influenza A     109702386 (Cxcl10)    05169 Epstein-Barr virus infection     109702386 (Cxcl10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109702386 (Cxcl10)    00536 Glycosaminoglycan binding proteins [BR:ccan00536]     109702386 (Cxcl10) Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Chemokines    109702386 (Cxcl10) Glycosaminoglycan binding proteins [BR:ccan00536]  Heparan sulfate / Heparin   Chemokines    109702386 (Cxcl10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  109702386 NCBI-ProteinID:  XP_020043327 UniProt:  A0A8B7WI76 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MNRSAILICCLIFLTLSVTEGMPLSRTIRCTCIEISNQPVNPRSIEKLEIIPASQSCTRV EIIAIMKKNGKKRCLNPESKAIKNVLKAISKERSKRSP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaccgaagtgccattcttatttgctgcctcatctttctgacactgagtgtaactgaa ggaatgcctctctctagaactatacgttgcacctgcattgagatcagtaatcaacctgtt aacccaaggtccattgaaaaacttgaaattattcctgcaagtcaatcttgtacacgtgtt gagatcattgccataatgaaaaagaatgggaaaaagagatgtctcaatccagaatccaag gccatcaagaatgtattgaaagccattagcaaagaaaggtctaaaagatctccttaa

DBGET integrated database retrieval system