Castor canadensis (American beaver): 109703025 Help Entry 109703025         CDS       T04791                                  Symbol Pfn4 Name (RefSeq) profilin-4   KO K05759   profilin Organism ccan  Castor canadensis (American beaver) Pathway ccan04015   Rap1 signaling pathway ccan04810   Regulation of actin cytoskeleton ccan05014   Amyotrophic lateral sclerosis ccan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     109703025 (Pfn4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     109703025 (Pfn4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109703025 (Pfn4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     109703025 (Pfn4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccan04131]     109703025 (Pfn4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccan04812]     109703025 (Pfn4)    04147 Exosome [BR:ccan04147]     109703025 (Pfn4) Membrane trafficking [BR:ccan04131]  Others   Actin-binding proteins    Others     109703025 (Pfn4) Cytoskeleton proteins [BR:ccan04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      109703025 (Pfn4) Exosome [BR:ccan04147]  Exosomal proteins   Proteins found in most exosomes    109703025 (Pfn4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  109703025 NCBI-ProteinID:  XP_020043829 UniProt:  A0A8C0W442 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPSDVGTLVNGFAKNPLQTR REGLYFKEMDYKCVRSDDYSLYAKNENNGLVVVKTHLYLLVATYTAGMYPSICVEATEKL GEYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccacttgcagaatttactgttagataccctcctggggacgaagcatgtggacagt gcagccctcatcaaacttcaggagaggagcctgtgtgtcgcatcaccaggatttagtgta atgccgagtgatgtcggaacacttgtgaatggatttgctaaaaaccctttgcaaacccga agggaaggattgtatttcaaggaaatggattacaaatgtgtacggtcagatgactattct ctttatgctaagaatgagaacaatggtttggttgttgtgaaaacccatctgtatctcctg gtggccacttacactgcaggcatgtatcctagcatctgtgtggaagccacagagaagctg ggagaatatctaagaaaaaaaggaaattaa

DBGET integrated database retrieval system