Cyprinus carpio (common carp): 109045364 Help Entry 109045364         CDS       T05134                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04060   Cytokine-cytokine receptor interaction ccar04218   Cellular senescence ccar04620   Toll-like receptor signaling pathway ccar04621   NOD-like receptor signaling pathway ccar04622   RIG-I-like receptor signaling pathway ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109045364  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     109045364  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109045364    04621 NOD-like receptor signaling pathway     109045364    04622 RIG-I-like receptor signaling pathway     109045364  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109045364  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccar04052]     109045364    00536 Glycosaminoglycan binding proteins [BR:ccar00536]     109045364 Cytokines and neuropeptides [BR:ccar04052]  Cytokines   Chemokines    109045364 Glycosaminoglycan binding proteins [BR:ccar00536]  Heparan sulfate / Heparin   Chemokines    109045364 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Gp_UL130 Motif Other DBs NCBI-GeneID:  109045364 NCBI-ProteinID:  XP_018918771 Ensembl:  ENSCCRG00000032899 UniProt:  A0A9Q9ZAC4 LinkDB All DBs Position A7:complement(6937838..6938807) Genome browser AA seq 107 aa AA seqDB search MSELYCSCAYALIFTMRKFTTSAFVLLTCMMLLSITEDISARPPIQQLRCQCVKTYSGKP INPKLIQKVQMISAGPQCRNVEIIATLKNGLTCLNPTDEWVKNILEA NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgtcagaactttactgttcatgtgcatatgcattaattttcacaatgaggaagttcacc acatcagcctttgttcttctgacctgcatgatgctgctgtccataacagaagacatctct gccagaccaccaatccaacagctacgctgccagtgtgttaaaacctattcgggaaaacca attaacccaaaactaatacagaaagtacaaatgatttctgctggaccacaatgcagaaac gtggagatcattgccactctgaaaaatggactgacgtgcctcaatcccactgacgagtgg gtgaaaaatatcctcgaagcatga

DBGET integrated database retrieval system