Cyprinus carpio (common carp): 109048465 Help Entry 109048465         CDS       T05134                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism ccar  Cyprinus carpio (common carp) Pathway ccar04010   MAPK signaling pathway ccar04137   Mitophagy - animal ccar04140   Autophagy - animal ccar04218   Cellular senescence ccar04371   Apelin signaling pathway ccar04625   C-type lectin receptor signaling pathway ccar04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ccar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109048465 (rras)    04371 Apelin signaling pathway     109048465 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109048465 (rras)    04137 Mitophagy - animal     109048465 (rras)   09143 Cell growth and death    04218 Cellular senescence     109048465 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109048465 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109048465 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109048465 (rras)    04031 GTP-binding proteins [BR:ccar04031]     109048465 (rras) Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109048465 (rras)   Exosomal proteins of bladder cancer cells    109048465 (rras) GTP-binding proteins [BR:ccar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109048465 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_14 Motif Other DBs NCBI-GeneID:  109048465 NCBI-ProteinID:  XP_042580055 Ensembl:  ENSCCRG00000049682 UniProt:  A0A9Q9WAY5 LinkDB All DBs Position A3:complement(22526806..22530745) Genome browser AA seq 196 aa AA seqDB search MSTEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGEETRLDILD TAGQEEFGAMREQYMRSGEGFLLVFALNDSGSYDEIQKFHTQILRVKDRDDFPMVLVGNK SDLDQQRVISRDEAMSFARENRIHYMESSAKNRHNVDEAFMEVVRAIRKFQETESPPLPA NHAGKQKSGGCPCTLL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgtcaactgaagaaagatataagttggtggtcgtgggcggtggaggtgtggggaaaagc gccctcactattcagttcattcagtcgtactttgtgtcggactatgacccaaccattgaa gattcatacactaaaatctgcaccgtggatggagaggagacacgattagacatcctggac acagcaggacaagaagagttcggagcgatgagagagcagtacatgcgctccggagagggt ttcttactggtgtttgctcttaatgacagtggcagttatgatgaaattcagaaatttcac actcagatattgcgggtgaaggatcgagatgattttcctatggttcttgttggcaacaaa tcagatcttgaccagcagagagtgatctcaagagatgaggcaatgtcgtttgcccgagaa aacaggatccactatatggaatcatcagctaagaaccgccacaatgtggatgaagccttc atggaggttgtgcgagcaataaggaagtttcaggagacagaaagtccaccgctccctgct aatcacgcggggaagcagaagagtggtggctgtccctgcaccctcctctga

DBGET integrated database retrieval system