Cyprinus carpio (common carp): 109048941 Help Entry 109048941         CDS       T05134                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism ccar  Cyprinus carpio (common carp) Brite KEGG Orthology (KO) [BR:ccar00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ccar03019]     109048941    03029 Mitochondrial biogenesis [BR:ccar03029]     109048941 Messenger RNA biogenesis [BR:ccar03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      109048941 Mitochondrial biogenesis [BR:ccar03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     109048941 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  109048941 NCBI-ProteinID:  XP_018922139 Ensembl:  ENSCCRG00000029320 UniProt:  Q9I9I0 Q5S1U4 LinkDB All DBs Position A18:complement(1559980..1560804) Genome browser AA seq 60 aa AA seqDB search MDPCDCAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgcgattgcgccaagactggaacttgcaactgtggtgccacctgcaagtgc actaattgccagtgtacaacctgcaagaagagttgctgttcctgttgcccgtctggttgc agcaagtgcgcctctggctgcgtgtgtaagggcaattcctgcggctccagctgctgtcaa tga

DBGET integrated database retrieval system