Cyprinus carpio (common carp): 109053000 Help Entry 109053000         CDS       T05134                                  Symbol cldn15la Name (RefSeq) claudin 15-like a   KO K06087   claudin Organism ccar  Cyprinus carpio (common carp) Pathway ccar03272   Virion - Hepatitis viruses ccar04382   Cornified envelope formation ccar04514   Cell adhesion molecule (CAM) interaction ccar04530   Tight junction Brite KEGG Orthology (KO) [BR:ccar00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     109053000 (cldn15la)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     109053000 (cldn15la)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     109053000 (cldn15la)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109053000 (cldn15la)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccar03037]     109053000 (cldn15la)    04147 Exosome [BR:ccar04147]     109053000 (cldn15la) Cilium and associated proteins [BR:ccar03037]  Other cilia and associated proteins   Stereociliary proteins    109053000 (cldn15la) Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    109053000 (cldn15la)   Exosomal proteins of colorectal cancer cells    109053000 (cldn15la) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM37 DUF7702 DUF4190 DUF7847 Motif Other DBs NCBI-GeneID:  109053000 NCBI-ProteinID:  XP_042620467 Ensembl:  ENSCCRG00000019073 UniProt:  A0A9R0B302 LinkDB All DBs Position A9:31485436..31487129 Genome browser AA seq 155 aa AA seqDB search MSTALEVTGFFMCLVGWIVTGLAVANDYWKISSVQGTVIISNRLYENLWHACGEDSSGKA NCQDFQSMLALPVHIQACRALTIITLILGLVGIILSTMGLKCIKIGSKTDESKGKTMVIG GIIFILAGLCTMVAVSWYAARIVAEFNDPFYGGVK NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtctacagcattagaagtgactggattcttcatgtgtttggtcgggtggattgtaact ggccttgctgtggctaatgactactggaagatatctagcgtgcaaggcacagtgatcatt tcgaaccgcctctatgagaacttgtggcatgcttgtggtgaggacagttctggaaaggcc aactgccaagattttcaatccatgttggctttgccagttcatattcaggcatgtcgagca ttaacgatcatcaccctgatcctggggttggtcggtataattttgtctaccatgggactg aagtgcattaagattgggtcaaaaacagatgagtcaaaaggcaaaactatggtcattggt ggcattatcttcatccttgcaggtctttgcactatggtggccgtatcttggtacgctgca cggattgttgcagaattcaacgacccattttatggtggcgtcaagtga

DBGET integrated database retrieval system