Cyprinus carpio (common carp): 109054274 Help Entry 109054274         CDS       T05134                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ccar  Cyprinus carpio (common carp) Pathway ccar04081   Hormone signaling ccar04144   Endocytosis ccar04150   mTOR signaling pathway ccar04270   Vascular smooth muscle contraction ccar04310   Wnt signaling pathway ccar04350   TGF-beta signaling pathway ccar04510   Focal adhesion ccar04520   Adherens junction ccar04530   Tight junction ccar04621   NOD-like receptor signaling pathway ccar04625   C-type lectin receptor signaling pathway ccar04810   Regulation of actin cytoskeleton ccar05100   Bacterial invasion of epithelial cells ccar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccar00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     109054274    04350 TGF-beta signaling pathway     109054274    04150 mTOR signaling pathway     109054274   09133 Signaling molecules and interaction    04081 Hormone signaling     109054274  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109054274   09144 Cellular community - eukaryotes    04510 Focal adhesion     109054274    04520 Adherens junction     109054274    04530 Tight junction     109054274   09142 Cell motility    04810 Regulation of actin cytoskeleton     109054274  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109054274    04625 C-type lectin receptor signaling pathway     109054274   09153 Circulatory system    04270 Vascular smooth muscle contraction     109054274  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109054274    05100 Bacterial invasion of epithelial cells     109054274  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccar04131]     109054274   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109054274    04031 GTP-binding proteins [BR:ccar04031]     109054274 Membrane trafficking [BR:ccar04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     109054274 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109054274   Exosomal proteins of other body fluids (saliva and urine)    109054274   Exosomal proteins of colorectal cancer cells    109054274   Exosomal proteins of bladder cancer cells    109054274 GTP-binding proteins [BR:ccar04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     109054274 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB Motif Other DBs NCBI-GeneID:  109054274 NCBI-ProteinID:  XP_018927109 Ensembl:  ENSCCRG00000008362 UniProt:  A0A9Q9ZC85 LinkDB All DBs Position B22:16962942..16967417 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELVKMKQEPVKPEEGRDMANRICAFGYMECSAKTKDGVREVFEMATRAALQ ARKGKKNSKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcggcgatccgtaagaagctggtgatcgtgggagacggcgcgtgcgggaagacctgt ctgctcatcgtcttcagcaaagaccagttccccgaggtctacgtgcccaccgtcttcgag aactacgtggccgacatcgaggtggacggcaagcaggtggagctagcgctgtgggacacg gcgggtcaggaggactacgaccggctgcggccgctctcttaccccgacaccgacgtcatc ctcatgtgcttctccatcgacagccccgacagcctggagaacattcccgagaaatggact ccggaggtcaagcatttctgccccaacgttcccataatcctggtgggcaacaagaaggat ctgcgcaacgatgaacacacccgccgcgagctcgtcaagatgaagcaggagcccgtcaag ccggaggagggccgggacatggccaaccgcatctgtgccttcggatacatggagtgctcc gccaagaccaaggatggcgtgcgggaggtgttcgagatggccaccagggcggcgctgcag gcccgcaagggcaagaagaacagcaagtgcctgctgctgtag

DBGET integrated database retrieval system